SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007955 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007955
Domain Number 1 Region: 18-196
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.37e-73
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000134
Further Details:      
 
Domain Number 2 Region: 191-323
Classification Level Classification E-value
Superfamily E set domains 4.43e-51
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.000000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007955   Gene: ENSMLUG00000008727   Transcript: ENSMLUT00000008731
Sequence length 545
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430140:183852:191034:-1 gene:ENSMLUG00000008727 transcript:ENSMLUT00000008731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSDLFPLIFPSEPAQAPGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKIIGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAINQRIQTNNNPFQVPMEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLSPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSTSVPKPAPQSYPFTPSLSTINF
EEFSPMVFSSGQIPNQPSALAPALVSAMTPALVQAPTPAPVPVLASASSLAQAVAPPAPK
PTQAGEGTLTEALLHLQFDADEDLGALLGNNTDPAVFTDLASVDNSEFQQMLNQGVSMAP
HTAEPMLMEYPEAITRLVTGSQNPPDPAPAPLGAAGLANGLLAGDEDFSSIADMDFSALL
SQISS
Download sequence
Identical sequences G1PC32
ENSMLUP00000007955 ENSMLUP00000007955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]