SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008448 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008448
Domain Number 1 Region: 258-481
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-63
Family Nuclear receptor ligand-binding domain 0.0000000017
Further Details:      
 
Domain Number 2 Region: 135-219
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-27
Family Nuclear receptor 0.00005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008448   Gene: ENSMLUG00000009273   Transcript: ENSMLUT00000009269
Sequence length 482
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429777:2817036:2861101:-1 gene:ENSMLUG00000009273 transcript:ENSMLUT00000009269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMQFQELENPAQISPCQSCTSSGSVMEMMSMKPAKGVLTEPTTGPLGQNLEVESYSQYN
NIQFPQVQPQISSSSYYSSLGFYPQQPEEWYSPGLYELKPLPTETLYQGETEVAEIPVTK
KPRMGTSAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCV
MDMYMRRKCQECRLRKCKEMGMLAECLLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLR
QVTSTTKSCREKTELTLDQQNLLHYIMDSYSKQRMPQEITNKILKEEFSAEENFLILTEM
ATSHVQILVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPAGHADLLEE
RIRKSGISDEYITPMFSFYKSVAELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEP
LLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWD
VQ
Download sequence
Identical sequences G1PDB5
XP_006084155.1.53796 ENSMLUP00000008448 ENSMLUP00000008448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]