SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009184 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009184
Domain Number 1 Region: 683-793
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000368
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 
Domain Number 2 Region: 122-229
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000191
Family Regulator of G-protein signaling, RGS 0.0071
Further Details:      
 
Domain Number 3 Region: 401-523
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000721
Family Regulator of G-protein signaling, RGS 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009184   Gene: ENSMLUG00000010082   Transcript: ENSMLUT00000010075
Sequence length 984
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429821:6364685:6397556:1 gene:ENSMLUG00000010082 transcript:ENSMLUT00000010075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPHIEIICSTNLIILLEDEIFADFFNTFLSLPVFGQTPFYTVENAQWSLWPEIPHDLIPK
YKGLLTWLGKYRLPFFCKTNLCFHYILCQELISFINSPEGAKMMRWKKADQWLLQKCIGG
VRGMWRFCTYLKGSAGEELVDFWILAEKILGIDEMDLELRDHYLSLLLVLKATHLQEGSR
VVTLCNMNIKSLLNLSIWHPNQSTTRREILSNMQKVALFKLQSYWLPNFHIHAKTIIAKE
ETCQHLMQEYETRQCSLCCSHLGELPLNMSIKKSCHPQRRYSSRKIKQKMWQLIDHASWS
LELDTKPGDNSTSSQEICPQEKVVVHMPSLKKASSKEGITSSLEKDSLSARKSNMKKKAK
SHLHMEGLFETKISTHLRTATPIIRHSPHLTIKGAIKKRLSLGYTHWALCADAFAGSPFR
DHLKKLNLKMEIQLLDLWQDLHHFLNVLMNNRKTGNAIFWHILGNRICELYLNEQIGPRL
PLKSQTIEGLKELLPSGNMNPWIPKAQEEICQMLSSWYEEFLNEEDSSFLTYATQTSVNH
TRRHKKDAISKQENILLYKRLEESLALSQGLANMEEMDSVQWRKLATEDLRHDGSLRVEL
KSPVFLTDIEKMSFEELCYKYPKVAIEKISEDYKIYCKKAPTNYQYKVYRQIITRESRTH
SPPPKEASLKKIPVVRKPSHRPRNLAEVFRNVQHLEYFTEFLKERKAEVPLQFLMALQKI
SIETDEQVSKSLVENVMETYFSDIVPAEEMLQCDDPIIREVSRKGRLSTNSMLILQSCVM
KSLEEKWFKEYQELFPDFPQEVQAQIRTVYRKPSKTSSMQIQEPQKRIWPKLVGFVKSFC
KYRRCMNNVNLRQEFEKYLHLELNNKENYPASPNVPARPSPHHSNVRSAEENGDVIFMKR
RIFGHRVITVNFALSDLYFFSEMERFNDLVSSAHVLQVSWAYNENDVILMKSKINIILKL
YLQSEVPPRLRVLFLEGNPLLLPE
Download sequence
Identical sequences G1PF58
ENSMLUP00000009184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]