SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009549 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009549
Domain Number 1 Region: 199-456
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.1e-82
Family Nuclear receptor ligand-binding domain 0.000000000884
Further Details:      
 
Domain Number 2 Region: 130-211
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.36e-31
Family Nuclear receptor 0.00000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009549   Gene: ENSMLUG00000010476   Transcript: ENSMLUT00000010476
Sequence length 460
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431827:463:19713:1 gene:ENSMLUG00000010476 transcript:ENSMLUT00000010476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLADFSTQVNSPLNSPTGRGSMAAPSLHPSLGPGLGAPLGSPGQLHSPISTLSSPINGMG
PPFSVISSPMGPHSMSVPTTPTLGFGTSSPQLSSPMNPVSSTEDIKPPLGLNGVLKVPAH
PSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKR
QRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRSESEVESTSSANEDMPVEKILEAELAV
EPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLR
AGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMHM
DKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRL
PALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
Download sequence
Identical sequences G1PG11
ENSMLUP00000009549 ENSMLUP00000009549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]