SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009550 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009550
Domain Number 1 Region: 413-607
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.3e-68
Family Nuclear receptor ligand-binding domain 0.000023
Further Details:      
 
Domain Number 2 Region: 127-216
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.99e-29
Family Nuclear receptor 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009550   Gene: ENSMLUG00000010485   Transcript: ENSMLUT00000010477
Sequence length 610
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430096:846488:853691:-1 gene:ENSMLUG00000010485 transcript:ENSMLUT00000010477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDSSNGSFQSLTQGCPTYFPPSPTGSL
TQDPARSFGSIPPSLSDDGSPSSSSSSSSSSFYNGSPPGGLQVALEDSSRVSPSKSTSSI
TKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNESCSIVRINR
NRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPMETSPV
QHPTPGPVGPSPPPAPAPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTY
AHDKLSSPGNFNANHVSANPPATTPHRWESQGCSPVPNDNNIMAAQRHNEALNGLHQPPS
YPPAWPPGPAQHSCHQPNSNGHRLCPTHVYPAPEGEAPANSPWQGNSKNVLLACPMNMYP
HGCSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMVRF
ASLFNVKDQTVMFLSRTTYSLQELSAMGMGDLLNAMFDFSEKLNSLALTEEELGLFTAVV
LVSADRSGTENSASVEQLQETLLRALRALVLKNRPSETSRFTKLLLKLPDLRTLNNMHSE
KLLSFRVDAQ
Download sequence
Identical sequences G1PG12
XP_006100883.1.53796 ENSMLUP00000009550 ENSMLUP00000009550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]