SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009781 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009781
Domain Number 1 Region: 70-256
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.61e-55
Family AlkB-like 0.0000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009781   Gene: ENSMLUG00000010708   Transcript: ENSMLUT00000010730
Sequence length 259
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429996:1182430:1185902:1 gene:ENSMLUG00000010708 transcript:ENSMLUT00000010730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRFLVKRALGGLVGKREQEQTGAGPAELGEEESTRKRPRRETPGNGADVAGLSWRRIRS
EDLDCDYTVLFGKAEADEIFRELEQEVEYFTGALAKVQVFGKWHNVPRKQATYGDTGLTY
TFSGLTLSPKPWIPVLERVRDRVSLVTGQTFNFVLVNRYKDGCDHIGEHRDDERELAPGS
PIASVSFGACRDFFFRHRDARGRSPSRRLEVVRLPLAHGSLLMMNHPTNSHWYHSLPVRK
KILAPRVNLTFRRILPTRK
Download sequence
Identical sequences G1PGL4
ENSMLUP00000009781 XP_006098378.1.53796 XP_006098379.1.53796 XP_006098380.1.53796 ENSMLUP00000009781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]