SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009890 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009890
Domain Number 1 Region: 182-259
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-20
Family SH3-domain 0.0000906
Further Details:      
 
Domain Number 2 Region: 2-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000209
Family LASP-1 0.003
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000009890
Domain Number - Region: 32-59
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000279
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009890   Gene: ENSMLUG00000010830   Transcript: ENSMLUT00000010848
Sequence length 260
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430096:95789:133152:1 gene:ENSMLUG00000010830 transcript:ENSMLUT00000010848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPNCARCGKIVYPTEKVNCLDKYWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQ
SFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNI
KYHEEFEKSRMGPSGGEGMEPERRDSQDSTSYRRPQEQQPHHIPTGTPVYQQPQQQQVAP
SYGGYKEPAAPVSTQRSAPSGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMY
GTVERTGDTGMLPANYVEAI
Download sequence
Identical sequences G1PGV9
XP_006100827.1.53796 ENSMLUP00000009890 ENSMLUP00000009890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]