SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009951 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009951
Domain Number 1 Region: 81-162
Classification Level Classification E-value
Superfamily HMG-box 2.75e-32
Family HMG-box 0.000021
Further Details:      
 
Domain Number 2 Region: 3-79
Classification Level Classification E-value
Superfamily HMG-box 3.27e-26
Family HMG-box 0.0000158
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000009951
Domain Number - Region: 177-203
Classification Level Classification E-value
Superfamily ARM repeat 0.025
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009951   Gene: ENSMLUG00000010926   Transcript: ENSMLUT00000010918
Sequence length 204
Comment pep:novel scaffold:Myoluc2.0:GL429807:3050373:3054725:-1 gene:ENSMLUG00000010926 transcript:ENSMLUT00000010918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSAKEKSKF
DEMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISI
GDVAKKLGEMWNNLSDSEKQPYNNKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKV
EEEDEEEEEEEEEEEEEEEEEEDE
Download sequence
Identical sequences G1PH15
ENSMLUP00000009951 XP_006087784.1.53796 XP_006087785.1.53796 XP_008156930.1.99482 XP_008156931.1.99482 ENSMLUP00000009951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]