SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009966 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009966
Domain Number 1 Region: 556-691
Classification Level Classification E-value
Superfamily PX domain 1.07e-21
Family PX domain 0.0022
Further Details:      
 
Domain Number 2 Region: 328-473
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.65e-21
Family Regulator of G-protein signaling, RGS 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009966   Gene: ENSMLUG00000010890   Transcript: ENSMLUT00000010934
Sequence length 946
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429919:1068668:1142415:-1 gene:ENSMLUG00000010890 transcript:ENSMLUT00000010934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPWVRTMGEKLKQRLRLDVGREICRQYPLFCFLLLCLSAASLLLNRYLHILMIFWSFVA
GVVTFYCSLGPDSLLPNMLFTIKYKPKQLGLQELFPQGRSCAVCGKVKCKRHRPSLLLEN
YQPWLDMKISSKVDASLSEVLELVLENFVYPWYRDVTDDESFVDELRITLRFFASVLIRR
IHKVDIPSIITKKLLKAAMKHIEVIVKASQKVENTEFLQQAALEEYGPELHVALRSRRDE
LHYLRKLTELLFPYVLPPKATDCRSLTLLLREILSGSVFLPSLDFLADPDTVNHLLIIFI
VDSPPEKATEPPSPLVPFLQKFAEPRNKKPSVLKLELKQIREQQDLLFRFMNFLKQEGAV
HVLQICLTVEEFNDRILRPELSNDEMLSLHEELQKIYKTYCLDESIDKIRFDPFIVEEIQ
KIAEGPYIDVVKLQTMRCLFEAYEHVLSLLENVFTPMFCHSDEYFRQLLRGAESPTRNSK
FNRGSLSLDDFRSTQKRGESFGISRIGSKIKGVFKSTTMEGAMLPNYGLAEGEDDFIEEG
IVVMEDDSPVEAVSTPNTPRNLAAWKISIPYVDFFEDPSSERKDKKERIPVFCIDVERND
RRAVGHEPEHWSVYRRYLEFYVLESKLTEFHGTFPDAQLPSKRIIGPKNYEFLKSKREEF
QEYLQKLLQHPELSNSQLLADFLSPNGGETQFLDKILPDVNLGKIIKSVPGKLMKEKGQH
LEPFIMNFINSCESPKPKPCKPELTILSPTSENNKKLFNDLFKNNANRAENTERKQNKNY
FMEMMTVEGVYDYLMYVGRVVFQVPDWLHHLLMGTRILFKNTLEMYTDYYIHCKLQQLFQ
EHRLVSLITLLRDAVFCENTEPRSLQDKQKRAKQTFDEMMNYIPDVIVKCIGEEAKYESI
RLLFDGLQQPVLNKQLTYVLLDIVIQELFPELNKVQKEVTSVTSWM
Download sequence
Identical sequences G1PH29
ENSMLUP00000009966 ENSMLUP00000009966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]