SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010119 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010119
Domain Number 1 Region: 56-182
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.44e-44
Family Regulator of G-protein signaling, RGS 0.000000691
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010119   Gene: ENSMLUG00000011109   Transcript: ENSMLUT00000011102
Sequence length 202
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429821:6421463:6425589:-1 gene:ENSMLUG00000011109 transcript:ENSMLUT00000011102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRTLSAFPTTCLERAKEFKTRLGIFLHKSDLSSDTGNAGKSEWNNKHSKERRNFSEDVL
GWRESFDLLLSSKNGVAAFHAFLKTEFSQENLEFWLACEEFKKIRSASKLASRAHRIFEE
FICSEAPKEVNIDHETRELTRTNLQAATATCFDVAQGKTRTLMEKDSYPRFLKSPAYQDL
AAQASATNASPSSGSSAEPSHT
Download sequence
Identical sequences G1PHG9
XP_006089049.1.53796 ENSMLUP00000010119 ENSMLUP00000010119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]