SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010142 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010142
Domain Number 1 Region: 222-481
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.83e-56
Family Glycerophosphoryl diester phosphodiesterase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010142   Gene: ENSMLUG00000011115   Transcript: ENSMLUT00000011126
Sequence length 542
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429771:13844302:13856348:-1 gene:ENSMLUG00000011115 transcript:ENSMLUT00000011126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKSPNCCSVWARSIHCLYSCHWRKCPKDRMKTSQCEYMWFGLLFFTVLLSLGWLYIGLI
LLNDLHNFNEFLFRQWGHWMDWSLAFTLFVSLLVTYASLLLLLAVLLWFCGQPLHLHSVH
KVLLLLIVLLVLAGLVVLDVQWQEEWLSLRLSLWATAPFLHIGAVAFITILAWPVADNFY
HIHKIGHKIVLLFVYFTIVLAIYLSPLCISSTCIMEPRDVSPKPRLVGHRGAPMLAPENT
LMSLRKTAECGANVFETDVMISSDGIPFLMHDEHLSRTTDVASVFPTRITAHSSDFSWAE
LKRLNAGAWFLKRPPFWEATQLSGLDRKEAENQTVPTLEELLKEAAVLNLSIMFDLRRPP
RNHTYYDTYVNLTLETVLNSRVPQAMVLWLPDEDRANVQQRAPRMHQIYGQLGVNRTERP
LFLNLPYQDLPQLDINLHRALHEDNVSVNLFVVNKPWLFSILWCAGVDSVTTNDCQLLQQ
MRYPVWLIPPKTYLMIWLLIDCVSTLLILWLFLLRGRCAEKREITGLETAVLLTRINNFI
ME
Download sequence
Identical sequences G1PHI9
ENSMLUP00000010142 ENSMLUP00000010142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]