SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010258 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010258
Domain Number 1 Region: 5173-5331
Classification Level Classification E-value
Superfamily SET domain 9.03e-49
Family Histone lysine methyltransferases 0.0065
Further Details:      
 
Domain Number 2 Region: 1175-1235
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000487
Family PHD domain 0.0039
Further Details:      
 
Domain Number 3 Region: 272-326
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000952
Family PHD domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1250-1318
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000117
Family PHD domain 0.025
Further Details:      
 
Domain Number 5 Region: 1129-1183
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000113
Family PHD domain 0.017
Further Details:      
 
Domain Number 6 Region: 215-274
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000108
Family PHD domain 0.015
Further Details:      
 
Domain Number 7 Region: 1777-1827
Classification Level Classification E-value
Superfamily HMG-box 0.00000209
Family HMG-box 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010258   Gene: ENSMLUG00000011179   Transcript: ENSMLUT00000011258
Sequence length 5331
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429858:2907100:2939828:-1 gene:ENSMLUG00000011179 transcript:ENSMLUT00000011258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSQKPPGEDKDSEPAADGHAASEESGATEADLPNPHVVEVSVPTSGGLRPQEPPQDRSG
GPLRRCALCNCGEPSLHGQRELRRFELPFDWPRCPVVSPGGNSEHSEAALPSEDLSQIGF
PEGLTPAHLGEPGGSCWAHHWCAVWSAGVWGKGGPELCGVDKAIFSGISQRCSHCTRLGA
SIPCRSPGCPRLYHFPCATASGSFLSMKTLQLLCPEHSEGAAHLEEARCAVCEGPGELCD
LFFCTSCGHHYHGACLDTALTARKRAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHT
FCLKPPMEELPAHSWKCKACRVCRSCGAGSAELNPNSEWFENYSLCYRCHKTQGGQPISS
VAEQRSAVCSRFSPPEPGDTPTDEPDALYVACQGQPKGGHVTSMQPKEPGPLQCEAKPLG
RAGAQLEPQLEAPLNEEMPLLPPPEESPLSPPPEESPTSPPPEASRLSPPPEESPLSPPP
EESPLSPPPESSPFSPLEESPFSPPEESPPSPPLETPLSPPPEASPLNPPFEESPLSPPP
EELPTSPPPEASRLSPPPEESPMSPPPEESPMSPPPEASRMFPPFEESPLSPPPEESPLS
PPAEASRLSAPPEESAGPRHRGDSAXRKGNNAGTLEMRSPLGEPHICRLLGEPVLSEPRV
PPLSPLPEELPLSPTREPSLSPQLMPPDPLPPPLSPIITAVAPPALSPLGELEYPFGAKG
DSDPESPLAAPILETPISPPPEANCTDPEPVPPMILPPSPGSPMGLASPILMEPLPPRCS
PLLQHSLPPQNSPPSQCSPPALPLSIPSPLSPIEKAMEVSHEAEPPEMEIEKAPEPECPA
LEPSPTSPLPSPMGNLSCPAPSPAPALEDFSGMGEDTAPLDGTDTPDSQPEAGQTPGSLA
SELKGSPVLLDPEELAPVTPMEVYGPECKQTGQGSPCEEQEEPRAPVAPTPPVLIKSDIV
NEISNLSQGDASASFPGSEPLLGSPDPEGGGSLSMELGVSTDVSPARDEGSLRLCTDSLP
ETDDSLLCDTGTAVSGGKAEGDKGKRRSSPARSRIKQGRSSSFPGRRRPRGGAHGGRGRG
RARLKSTTSSIETLVVADIDSSPSKEEEDDDDDTMQNTVVLFSNTDKFVLMQDMCVVCGS
FGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWRCVECIVCEVCGQASDPSRLLLC
DDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGAASPGFHCEWQNSYTHCGPCASLV
TCPICHAPYVEEDLLIQCRHCERWMHAGCESLFTEDDVEQAADEGFDCVSCQPYVIKPAA
PVAPPELVPMKVKEPEPQYFRFEGVWLTETGMAVLRNLTMSPLHKRRQRRGRLGLPGEAG
LEGSEPSDALGPDDKKDGDLDTEELLKGEGGVEHMECEIKLEGPISPDVEPGKEETEESK
KRKRKPYRPGIGGFMVRQRKSHTRVKKGPAAQAEVLSGDGQPDEVMPTDLPAEGSVEQSP
ADAEEKKKQQRRGRKKSKLEDMFPAYLQEAFFGKELLDLSRKALFAVGMGRPSFALGTPK
AKGDGGSDRKELPTLQKGDDGTEVADEESRGAEGKADTPGPEDGGVKASPVPSDPEKPGT
PGEGMLSSDLDRIPTEELPKIESKDLQQLFKDVLGSEREQHLGCGTPGLDGSRTPLQRPF
LQGGLPLGNLPSSSPMDSYPGLCQSPFLDSRERGGFFSPEPGEPDSPWTGSGGTTPSTPT
TPTTEGEGDGLSYNQRSLQRWEKDEELGQLSTISPVLYANINFPNLKQDYPDWSSRCKQI
MKLWRKVPAADKAPYLQKAKDNRAAHRINKVQKQAESQINKQTKVGDMARKTDRPALHLR
IPPQPGALGSPPPAAAPTIFIGSPTTPAGLSTSADGFLKPPAGTVPGPDSPGELFLKLPP
QVPAQVPSQDPFGLAPAYALEPRFPTAPSTYPPYPSPAGAPVQPPTLGTSSRPGTGQPGE
FHTTPPGTPRHQPSTPDPFLKPRCPSLDNLAVPESPGVGGGKASEPLLSPPPFGESRKAL
EVKKEELGASSPSYGPPNLGFVDSPSSGPHLGSLELKAPDVFKAPLTPRASQVEPQSPGL
GLRPQEPSPAQALAPSPPSHSDIFRPGPYPDPYAQPPLTPRPQPPAPESCCALPPRSLPS
DPFSRVPASPQSQSSSQSPLTPRPLSAEAFCPSPVTPRFQSPDPYSRPPSRPQSRDPFAP
LHKPPRPQPPEVAFKSGPLAHTPLGAGGFPAALPSGPAGELHAKVPSGQPPNFARSPGTG
AFVGTPSPMRFTFPQAVGEPSSLKPPVPQPGLPPPHGINSHFGPGPTLGKPQSTNYSVAT
GNFHPSGSPLGPSSGSTGEGYGLSPLRPQSVLPPPVPDGSLPYPPHGASQRAGITSPVDK
REDPGAGMAGSLAAPELPGTQDPGISSLSQTELEKQRQRQRLRELLIRQQIQRNTLRQEK
ETAAAAAGAVGPPGNWGTEPSNPAFEQLSRGQTPFAGTQDKSSLGLPSNKLGGPILGPGA
FPSDDRLSRPPPPATPSSMDVNSRQLVGGSQAFYQRAPYPGSLPLQQQQQHLWQQQQQQQ
ATAANSMRLAMSSRFSSTPGPELGRQNLGSPLAGLPTRLPGPGEPVPGPAGPAQFIELRH
NVQKGLGPGGPPFPGQGPPQRPRFYPVSEDSHRLAPEGLRGLTVSGLPPQKPSAPLAPEL
NNSLHPAPNTKGPTLPPGLELVSRPPSSTELGRPPPLVLEAGKLPCEDPELDDDFDAHKA
LEDDELAHLGLGVDVAKGDDELGTLENLETNDPHLDDLLNGDEFDLLAYTDPELDTGDKK
DIFNEHLRLVESANEKAEREALLRGVEPGPLGPEERPPPAADASEPRLAPVLPEVKPKVE
EGGRHPSPCQFTITNPKVEPAPATTSLGLGLKPGQSVMGSRDTRMGTGPFSSSGHTGATG
GPPAHLLTPNPLSGPGGSSLLEKFELESGALTLPGGHAASGDELDKMESSLVASELPLLI
EDLLEHEKKELQKKQQLSAQLQPVQQQQQHSLLSTPGPAQAMSLPHEGSSSTLAGPQQQL
ALGLGGSRQPGLAQPLMPTQPPAHALQQRLAPSLAMVSNQGHMISGQHGGQAGLVSQQSP
QPVLAQKPMGTMPPSMCMKPQQLAMQQQLANSFFPDTDLDKFAAEDIIDPIAKAKMVALK
GIKKVMAQGSIGVAPGMNRQQVSLLAQRLSGGTGSDLQNHVAAGSGQERNAGDPSQARPN
PPTFAQGVINEADQRQYEEWLFHTQQLLQMQLKVLEEQIGVHRKSRKALCAKQRTAKKAG
REFPEADAEKLKLVTEQQSKIQKQLDQVRKQQKEHTNLMAEYRNKQQQQQQQQQQQQQQQ
QQQQQQQQQQQHSAVLALSPSQSPRLLTKLPGQLLPGHALQPPQGPPGGQAAGLRLPPGG
MALPGQPGGPFLNTTLAQQQQQQHSGGAGALAGPSGGFFPGNLALRGLGPESRLLQERQL
QLQQQRMQLAQKLQQQQQQHLLGQVAIQQQQQQGPGIQANQALGPKPQGLLPSSSHQGLL
VQQLSPQPPQGPQGMLGPAQVAVLQQQQPHPGALGPQGPHRQVLLTQSRVPSSPQLAQQS
QGLMGHRLVTAQQQQQQQQQQHQQHQQQGPMAGLSHLQQGLMPHSGQPKLSTQPMASLQL
QQQQQQQLQQQQQLQQQQQLQQQQQLQQQQQIQQQQQQLQQQQLQQQQLQQQQQLQQQQQ
QLQQQQQLQQQQQLQQQQQLQQQQQQQQLQQQQLQQQQQLQQQQQQQIGLLNQSRTLLSP
QQQQQQVTLGPGMPAKPLQQHFSSPGALGPTLLLSGKEQSIVETTLPPEATEGPSTHQGG
VAIGTVPEAVPTEPGEVKPSLSGDSQLLLVQPQAQPQPNSVPLQPPLRLQGQQQQQQVNL
LHTAGVGSHGQSNSGSSSEASSVPHLLTQSSVSLGEQPGPITQNPLGSQQHHGLERPLQN
NAGPQPAKPGSVPQSGQGLPGAGVMPTVGQFRAQLQGVLAKNPQLRHLSPQQQQQLQALL
MQRQLQQSQAIRQAPSYQEPGTQPSPLQGLLGRQPQVGGFPGSQTGPLQELGAGLRPQGP
PRLPAPQGALSTGPVPGPVHPTPPPSSPQEPKRPSQLPSPSSQLPSEAQLPPTQPGTPKP
QALPLELPPGKISPAAAQLADTLFGKGLGPWDPPDNPAEAQKPEQSSLVPGHPEQVNGQA
VPEPSYLSIKQEPREEPCALGAQVVKREANGEPIGTPGTSNHLLLAGPRSEAGHLLLQKL
LRAKNVQLSTGRGPEGLRTEINGHIDSKLAGLEQKLQGTPSNKEDTAARKPLTPKPKRVQ
KASDRLVSSRKKLRKEDGVRASEALLKQLKQELSLLPLTEPTITANFSLFAPFGSSCPIN
GQCQLRGTFGSGALPTGPDYYSQLLTKNNLSNPPTPPSSLPPTPPPSVQQKMVNGVTASE
ELGEHPKDAASARDTEGTLRDASEVKSLDLLAALPTPPHNQTEDVRMESDEDSDSPDSIV
PASSPESILGEEAPRFPQLGSGQWEQEDRALSPVIPIIPRASIPVFPDTRPYGALDLEAP
GKLPATTWEKGKGSEVSVMLTVSAAAAKNLNGVMVAVAELLSMKIPNSYEVLFPESPARA
GIEPKKGDAEGPGGKEKSLGGKSPEAGPDWLKQFDAVLPGYTLKSQLDILSLLKQESPIP
EPPTQHSYTYNVSNLDVRQLSAPPPEEPSPPPSPLAPSPASPPAEPLVELPAEPSIEPPV
PSPLPLASSPESTRPKPRARPSEEGEDCRSPRLKKWKGVRWKRLRLLLTIQKGSGQQEDE
REVAEFMEQLGTALRPDKVPRDMRRCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWS
TEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSCNRMRCPNVYHFACAIRAKCMFF
KDKTMLCPMHKIKGPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLHMFRVGGLVFH
AIGQLLPHQMADFHSATALYPVGYEATRIYWSLRTNNRRCCYRCSIGENNGRPEFIIKVM
EQGLEDLVFTDASPQAVWNRIIEPVAAMRKEADMLRLFPEYLKGEELFGLTVHAVLRIAE
SLPGVESCQNYLFRYGRHPLMELPLMINPTGCARSEPKILTHYKRPHTLNSTSMSKAYQS
TFTGETNTPYSKQFVHSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEY
IGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVV
TFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQHKIPCHCGAWNCRKWMN
Download sequence
Identical sequences G1PHU9
ENSMLUP00000010258 ENSMLUP00000010258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]