SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011106 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011106
Domain Number 1 Region: 1299-1403,1460-1619
Classification Level Classification E-value
Superfamily Cullin homology domain 1.31e-39
Family Cullin homology domain 0.0013
Further Details:      
 
Domain Number 2 Region: 899-1055
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-34
Family APC10-like 0.005
Further Details:      
 
Domain Number 3 Region: 453-527
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.82e-32
Family CPH domain 0.00000705
Further Details:      
 
Domain Number 4 Region: 183-255,566-655,731-917
Classification Level Classification E-value
Superfamily ARM repeat 0.000000995
Family PBS lyase HEAT-like repeat 0.065
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000011106
Domain Number - Region: 1634-1733
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0272
Family Penicillinase repressor 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011106   Gene: ENSMLUG00000012163   Transcript: ENSMLUT00000012190
Sequence length 1785
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430085:657610:671986:-1 gene:ENSMLUG00000012163 transcript:ENSMLUT00000012190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGSGQVAAPRAGRWHRGWAPPRPAPGAADLRAGSGDSTAGHAPSRLPISTPFGGPSAS
MVGELRYREFRVPLGPGLHAYPDELIRQRWGHNGHPEYQIRWLVLRRGEDGEGGSSQVDC
KAEHILLWMSSDEIYANCHKMLGEDGQVIWPSQETAGEAGALDKSVLEEMETDVKSLIQR
ALRQLEECVGTMPPAPLLHTVHVLSAYASIEPLTGVFKDPRVLDLLMHMLSSPDYQIRWS
AGRMIQALASHDAGEEQCGEEGRAGERLGRLRALQEPLTSSIHKLLRTRTQILLSLSQQE
AIEKHLDFDSRCALLALFAQATLSEHPMSFEGIQLPQVPGRLLFSLVKRYLHVASLLDQL
NDSAAEPGAQNSSAPEELSRERGRLELEFSMAMGTLISELVQAMRWDWASSRQGPLARSS
CSIFQPQLADAGLALPPTQAQSSLRRSRRFRPRSEFASGNTYALYVRDTLQPGMRVRMLD
DYEEISAGDEGKFQQSNNGVPPVQVLWESTGRTYWVHWHMLEILGFEEDIEDMAEADEYR
GAVGSGAQGVALPSWRWKPMAELYAVPYVLPEDEDTEDSEHLTQAEWWELLFFIKKLDGP
DHQEVLQILQENLDGEVLDDEILAELAVPMELAQDLLLALPERLDDSALRDLLSCRVYRK
YAPEALAGQPAYPSLLDAQAQPQESADAARVEAEEPPTQQCPRSPLRHLVEGYGPAGKIV
LDLEQALSSEGTQESEVKSLLLLLRQQPQPFLVLMQSLDTPAANRALHLAVLRILMRLVD
FPEALLLPWHEAMDACMACLRSPDADREVLQELIFFLHRLASASRDYAVVLNQLGARDAV
SKALEKHLGKLDLAQELRDMVFKCEKHAHLYRKLTTNILGGCIQMVLGQIEDYRRTHRPI
NIPFFDVFLRYLCQGSSVEVKEDKCWEKVEVSSNPHRASRLTDRNPKTYWESNGSTGSHS
ITVHMRQGVLIRQLTLLVAGEDSSYMPARVVVFGGDSASSLNTELNSVNVMPSARRVVLL
ENLNRFWPVIQIRIKRCQQGGIDTRIRGLEVLGPKPTFWPVFREQLCRHTRLFYMVRAQA
WSQDIAEDRKRLLHLSSRLNGALRQEQNFADRFLPDDEAAQALGKTCWEALVSPLVQNIT
CPDEDGVSPLGWLLDQYLQCREAAHNPQSRAAAFSSRVRRLTHLLVHVEPCEVPAAAGAR
RPNGRNRSHDWGSLATPGLPSSIVKNLTRCWQAAVEEQVNSFLTSHWRDDDFVPRYCEHF
NNLQKSSSELFGPRAAFLLALQNGCAGALLKLPFLQAAHVSEQFARHIDQRIQGSRIGGA
RGMEMLAHLQRCLETVLIFSGLEIATTFEHYYQHYMADRLLSLGSSWLEGAVLEQIGPCF
PHRLPQQMLRTLSTSEELQRQFHVYQLQRLDQELLKLEDTEKKIQVGASQETSGKEHVGE
RQEEAEEAGAAAAAEVTEEEEEENEDLFYEGAMPEVSVLVLSPRCWPTASICHTLNPKTC
LPSYLRGTLNQYSNFYNKSQSYPVLEQGPQRRLQWTWLGRAEVQFGDQTLHVSTVQMWLL
LYLNDLKAVSVENLRALSGLPADTLNQAIGLLTSSRGPLDLHEQKDIPGGVLKIRDDSEE
PRPRRGNVWLIPPQTYLKAEDEEGRNLEKRRNLLNCLIVRILKAHGDEGLHVGQLVYLVL
EAWQKGPCPPRALVSGLGRGSACSSTDVLSCILHLLGKGTVRRRDDRPQMLSYAVPVTVM
EPHTESLNPGSSGPNPPLTFHTLQIRSRGVPYASCTATQSFSTFR
Download sequence
Identical sequences G1PK07
ENSMLUP00000011106 ENSMLUP00000011106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]