SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011200 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011200
Domain Number 1 Region: 44-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.43e-36
Family SCAN domain 0.0000565
Further Details:      
 
Domain Number 2 Region: 462-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.66e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 406-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.96e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 658-714
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 601-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.32e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 545-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.18e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 699-751
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-20
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 166-225
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.07e-18
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 9 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-16
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 10 Region: 508-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000241
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000011200
Domain Number - Region: 315-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0201
Family Classic zinc finger, C2H2 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011200   Gene: ENSMLUG00000012300   Transcript: ENSMLUT00000012301
Sequence length 762
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430482:139563:156149:-1 gene:ENSMLUG00000012300 transcript:ENSMLUT00000012301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPSKRMTSSSRSQVFLMWKPDKAQSGPNKAEKETLASRLLRDTETCRQNFRNFPYPDL
AGPRKALNQLRELCLKWLRPEIHSKEQILDLLVLEQFLTILPGEVRTWVKSQYPESSEEV
VTLVEDLTQILEDEAAPPNSAFSQEIPEEDPKGRHAFQAGWLNDLVTKESMTFRDVAVDI
TQEDWELMRPVQKELYKTVTLQNYWNMVSLGLTVYRPTVIPILEEPWMVMKEILEGPTPG
WETEAQDCNPVKNIPGYTTDGTQTIKMEEPYDYGDRLERQTPDTFMKIPTNERNFSLKSV
FSQEDDPTGEYLSNYDIYGNHFEKHSNLIIQFDTHSDNKTYTYDESMATFNHISYGIVHR
KFYPGEKPYKCNVCGKKFRKYPSYVKHQSTHTKEKSYECEECGKEFRHLSSLIAHQRMHT
GEKPYECHQCGKAFSQRAHLTIHQRIHTGEKPYKCDDCGKDFSQRAHLTIHQRTHTGEKP
YKCLECGKTFSHSSSLINHQRVHTGEKPYICNECGKTFSQSTHLLQHQKIHTGKKPYKCN
ECWKVFSQSTYLIRHQRIHSGEKCYKCNECGKAFAHSSTLIQHQTTHTGEKAYICKICGK
AFSQSANLTQHHRTHTGEKPYKCTVCGKAFSQSVHLTQHHRIHNGEKPFKCNICGKAYRQ
GANLTQHQRIHTGEKPYKCNVCGKAFIYSSSLNQHHRTHTGERPYKCNECDKDFSQRTCL
IQHQRIHTGEKPYACRICGKTFTQSTNLIQHQRVHTGTKHRN
Download sequence
Identical sequences G1PK89
ENSMLUP00000011200 XP_006105741.1.53796 ENSMLUP00000011200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]