SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011259 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011259
Domain Number 1 Region: 102-167
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000277
Family Ovomucoid domain III-like 0.0014
Further Details:      
 
Domain Number 2 Region: 199-244
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000116
Family Ovomucoid domain III-like 0.006
Further Details:      
 
Domain Number 3 Region: 36-73
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000105
Family TB module/8-cys domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011259   Gene: ENSMLUG00000012356   Transcript: ENSMLUT00000012366
Sequence length 264
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430150:824353:829120:-1 gene:ENSMLUG00000012356 transcript:ENSMLUT00000012366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPRAPGPLWPLPWGALAWAVGFVGSVGSGDPSPGGVCWLQQGKEATCSLVLKTDVSQAE
CCASGNIDTAWSNFTHPGNKISLLGFLGLVHCLPCKDSCEGVECGPGKACRMLGGRPRCE
CTPDCEELPARLQVCGSDGATYRDECELRAARCRGHPDLRVMYRGRCPQESCAHVVCQRP
QSCVVDQTGSAHCVMCRAAPCPAPSSPGQELCGNNNVTYMSSCHLRQATCFLGRSIGVRH
PGSCAAGTPEPADVESEEEEENFV
Download sequence
Identical sequences L7N1M9
ENSMLUP00000011259 ENSMLUP00000011259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]