SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011327 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011327
Domain Number 1 Region: 345-465,515-754
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 1.44e-59
Family Tex N-terminal region-like 0.0083
Further Details:      
 
Domain Number 2 Region: 775-929
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.59e-23
Family Tex RuvX-like domain-like 0.0087
Further Details:      
 
Domain Number 3 Region: 944-1036
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000000000289
Family Tex HhH-containing domain-like 0.0065
Further Details:      
 
Domain Number 4 Region: 1324-1415
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000249
Family SH2 domain 0.0033
Further Details:      
 
Domain Number 5 Region: 1225-1282
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000936
Family Cold shock DNA-binding domain-like 0.0099
Further Details:      
 
Domain Number 6 Region: 1049-1137
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000667
Family Tex HhH-containing domain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011327   Gene: ENSMLUG00000012423   Transcript: ENSMLUT00000012438
Sequence length 1724
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429924:1538684:1562965:1 gene:ENSMLUG00000012423 transcript:ENSMLUT00000012438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDFVESEAEESEEEYNDDGEVMPRVTKKFVEEEDDDEEEEEENPDDQDEQGNLKGFIND
DEDEGEEDEGSDSGDSEDDVGHKKRKRTSFDDRLEDDDFDLIEENLGVKVKRGQKYRRVK
KMSDDEDDDEEEYGKEEHEKEAIAEEIFQDGEGEEGQEAVEAPMAPAEEEEEDDEESDID
DFIVDDDGQPLKKPKWRKKLPGYTDAALQEAQEIFGVDFDYDEFEKYNEYDEELEEEYEY
EDDEAEGEIRVRPKKTTKKRVSRRSIFEMYEPSELESSHLTDQDNEIRATDLPERFQLRS
IPVKVAEDDELEEEADWIYRNAFATPTISLQESCDYLDRGQPASSFSRKGPSTIQKIKEA
LGFMRNQHFEVPFIAFYRKEYVEPELHINDLWRVWQWDEKWTQLRIRKENLTRLFEKMQA
YQYEQISADPDKPLADGIRALDTTDMERLKDVQSMDELKDVYSHFLLYYGRDIPKMQNAA
KANRKKLKRVREEGDEEGEGEEAEDEEQRGPELKQASRRDMYTICQSAGLDGLAKKFGLT
PEQFGENLRDSYQRHETEQFPAEPLELAKDYVCSQFPTPEAVLEGARYMVALQIAREPLV
RQVLRQTFQERAKLNITPTKKGRKDVDEAHYAYSFKYLKNKPVKELRDDQFLKICLAEDE
GLLTIDISIDMKGVEGYGNDQTYFEEIKQFYYRDEFSHQVQEWNRQRTMAIERALQQFLY
VQMAKELKNKLLVEAKEYVIKACSRKLYNWLRVAPYRPDQQVEEDDDFMEENQGKGIRVL
GIAFSSARDHPVFCALVNGEGEVTDFLRLPHFTKRRTAWREEEREKKAQDIETLKKFLLN
KKPHVVTVAGENRDAQMLIEDVKRIVHELDQGQQLSSIGVELVDNELAILYMNSKKSEAE
FRDYPPVLRQAVSLARRIQDPLIEFAQVCSSDEDILCLKFHPLQEHVVKEELLNALYCEF
INRVNEVGVDVNRAIAHPYSQALIQYVCGLGPRKGTHLLKILKQNNTRLESRTQLVTMCH
MGPKVFMNCAGFLKIDTASLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESAED
ANPAGALEEILENPERLKDLDLDAFAEELERQGYGDKHITLYDIRAELSCRYKDLRTAYR
SPNTEEIFNMLTKETPETFYIGKLIICNVTGIAHRRPQGESYDQAIRNDETGLWQCPFCQ
QDNFPELSEVWNHFDSGSCPGQAIGVKTRLDNGVTGFIPTKFLSDKVVKRPEERVKVGMT
VHCRIMKIDIEKFSADLTCRTSDLMDRNNEWKLPKDTYYDFDAEAADHKQEEDMKRKQQR
TTYIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVSDGIYQHVD
VREEGKENAFSLGATLWINSEEFEDLDEIVARYVQPMASFARDLLNHKYYQECSGGDRKK
LEELLIKTKKEKPTFIPYFICACKELPGKFLLGYQPRGKPRIEYVTVTPEGFRYRGQIFP
TVNGLFRWFKDHYQDPVPGITPSSSSRTRTPASINATPANLNLADLTRAVNALPQNMTSQ
MFSAIAAVTGQGQNPNATPAQWASSQYGYGGSGGGSSAYHVFPTPAQQPVATPLMTPSYS
YTTPSQPITTPQYHQLQASTTPQSAQAQPQPSSSSRQRQQQPKSNSHAAIDWGKMAEQWL
QEKEAERRKQKQRLTPRPSPSPMIESTPMSIAGDATPLLDEMDR
Download sequence
Identical sequences G1PKJ6
ENSMLUP00000011327 ENSMLUP00000011327 XP_006095589.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]