SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011783 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011783
Domain Number 1 Region: 219-300
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-24
Family SH3-domain 0.00045
Further Details:      
 
Domain Number 2 Region: 6-67
Classification Level Classification E-value
Superfamily SH3-domain 1.08e-21
Family SH3-domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011783   Gene: ENSMLUG00000012949   Transcript: ENSMLUT00000012954
Sequence length 616
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429816:1095357:1251699:1 gene:ENSMLUG00000012949 transcript:ENSMLUT00000012954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GERRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKEL
SGESDDLSISQDEQLSKSRPEALLPPASLLPFPAHGAKGKTTFEGTILYRAAPGKTEGHR
RYYSLRETTGSESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRS
IEVENDFLPVEKTIGKKLPPATATQDSSKTEMDSRTKTKDYCKVIFPYEAQNDDELTIKE
GDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQ
GAGTTERKHEIKKIPPERPETLPNRTEEKERPDREPKLDLQKPSVPAIPPKKPRPPKTNS
LSRPGALPPRRPERPVGPLTHTRGDGAKIDLVGSSLSGILDKDLSDRSNDIDLEGFDSVV
SSTEKLSHPTTSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHVSLAHRGVDTS
KKTSKTVTISQVSDNKAPLPPKPGTMAAGGGGGPATLSTVVPAPLSSSLGTAGHRANSPS
LFGTEGKPKMEPVAISQAALEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRL
RLQMEVNDIKKALQSK
Download sequence
Identical sequences G1PLP2
ENSMLUP00000011783 ENSMLUP00000011783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]