SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012000 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012000
Domain Number 1 Region: 93-152
Classification Level Classification E-value
Superfamily SH3-domain 1.1e-19
Family SH3-domain 0.00038
Further Details:      
 
Domain Number 2 Region: 195-266
Classification Level Classification E-value
Superfamily SH3-domain 6.96e-19
Family SH3-domain 0.00096
Further Details:      
 
Domain Number 3 Region: 758-865
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-17
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 4 Region: 368-455
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-16
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 5 Region: 976-1058
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000129
Family SH3-domain 0.00092
Further Details:      
 
Domain Number 6 Region: 1-58
Classification Level Classification E-value
Superfamily PX domain 0.0000000000392
Family PX domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012000   Gene: ENSMLUG00000013186   Transcript: ENSMLUT00000013191
Sequence length 1060
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429929:1696734:1795495:-1 gene:ENSMLUG00000013186 transcript:ENSMLUT00000013191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLPGKILFRRSHIRDVAVRRLKPIDEYCRALVRLPPHISQCDEVFQFFEARPEDVNPPKD
FGGSSADSEVWLSSWAESPKKDVTGADTSAEPMILEQYVVVSNYKKQENSELSLQAGEVV
DVIEKNESGWWFVSTSEEQGWVPATYLEAQNGTRDDSDINTSKSGEVSKRRKAHLRRLDR
RWTLGGMVNRQHSREEKYVTVQPYTSQSKDEIGFEKGVTVEVIRKNLEGWWYIRYLGKEG
WAPASYLKKAKDDLPARKKNLAGPVEIIGNIMEISNLLNKKTSGDKETPPAEGEGPEAPI
AKKEISLPILCNASNGSALGIPERTVSKLAQGSPAVARIAPQRAQISSPNLRTRPPPRRE
SSLGFQLPKPPEPPSVEVEYYTIAEFQSCISDGISFRGGQKAVVIDKNSGGWWYVQIGEK
EGWAPASYIDKRKKPNLSRRTSTLTRPKVPPPAPPSKPKEAEEGPAGTAETQDSPLKLKY
EEPEYDIPAFGFDSEPELSEEPTEDRGSGDKRLAQPHRPSPASSLQRARFKVGGSSEDVA
LEEETIYENEGFRPCAEDTLSARRSSRDSDSPGGSPLSLARKNSPKSDSPKSSSLLKLKA
EKNAQAELGKNHSSASFSSSITINTTCSSSSSSSSSSLSKPSSDLKPRSASDAGIRGTPK
VGAKKDADLKAGLTSCARAKPSVRPKPFLNRAESQSQEKMDISTLRRQLRPTGQLRGGLK
GSKSEDSELPPQTASEGPNEGSRRGSADLITLPAATPPCPTKKGREGQATSYMTCSAYQK
VQDSEISFPAGVEVQVLEKLESGWWYVRFGELEGWAPSHYLVLGENEPPDPSGKEPDAVT
AKSKQKEGKSDSLEKIEKRVQALNTVNQSKRATPPIPSKPPGGFSKTAGAGVVKMRNGVR
QVAVRPQSVFVSPPPKDNNLSCALRRNESLTATDSLRGVRRNSSFSTARSAAAEAKGRLA
ERAASQGSDSPLLPTQRNGIPVSPVRPKPIEKSQFIHNNLKDVYVSIADYEGDEETAGFQ
EGVSMEVLERNPNGWWYCQILDGVKPFKGWVPSNYLEKKN
Download sequence
Identical sequences G1PM84
ENSMLUP00000012000 ENSMLUP00000012000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]