SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012026 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012026
Domain Number 1 Region: 270-347
Classification Level Classification E-value
Superfamily HMG-box 1.23e-16
Family HMG-box 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012026   Gene: ENSMLUG00000013205   Transcript: ENSMLUT00000013218
Sequence length 1539
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430343:340588:384989:-1 gene:ENSMLUG00000013205 transcript:ENSMLUT00000013218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLTAQARPSYLKALLQCLGAGQRGPPTASDRGFLLLPELPAQKSPSALAVPSTSIQFLWA
RPSAGAGLLRLRKGCTQALRWPLPVRREGRRDGSPRRFECCCYCYSCCGPQRRPGAAATP
AFLLSSSGFPGPDPGPLQASLKSLRSPVLPHLPSKTSYRDSEEEEQRKGLSRLRAVCRRA
GSRGLGSSSPRDARASPRLHFLVATVTTGAASRRQRGARGRGPARSSSPRAGCLRECEPR
GVHASRAMDASYDGTEVTVVMEEIEESYCYTSPGPPKKKKKYKIHGEKAKKPRSAYLLYY
YDIYLKVQQELPHLPQSEINKKISESWRLLSVAERSYYLEKAKLEKEGLDPNSKLSTLTA
VVPDIPGFRKILPRSDYIIIPKSSLQEDRSCPQLELCVAQNQVSSKGPSLVSNTALETVP
SHAGMAEQCMAVEALTEEVGALAQPGAVQEITTSEILSQDVLLEEASLEVGESHQPYQTS
LVIEETLVNGSPDLPTGSLAVPQPQVGESMSVVTVMRDSSESSSSAPATQFIMLPLPAYS
VVENPTSIKLTTTYTRRGHGTCTSPGCSFTYVTRHKPPKCPTCGNFLGGKWIPKEKPAKV
KVELASGVSSKGSAVKRNQQPVLTEQNASKETTSQLTLENSEAVSQLLSVAPPREVGEEN
EWEEVIISDAHVLVKESPGNRGTAVTKTPVVKSGVQPEVSLRTTENDSPSPDMPPPAEGT
STSSPPPASKKLTGVDLITPGPRASELKGRARGKPSLLAAARPMRAILPAPANVGRGSSM
GLPRARQAFSLSDKTPSVRTCGLKPSTLKQLGQPIQQPSNTGEVKCPKDMQKRTSQFKVV
EVKPDMFPPYKYSCTVTLDLGLATSRGRGKCKNPSCSYVYTNRHKPRICPSCGFNLAKDR
TEKTTKALEASSALPDGLSVTEPLSAAQREIQRQSTLQLLRKVLQIPENESELAEVFALI
HELNSSRLILSSVSEETVTIEQTSWSNYYESPSTQCLLCSSPLFKGGQNSLAGPQECWLM
TANRLQVVTAQVKMCLNPHCLALHSFMDIYTGLFNVGNKVLVSLDLLFAIRNQIKLGEDP
RVSISAVLKSVQEQAEKTLASEELSQLQELLCNGYWAFECLTVRDYNDMICGICGVAPKV
EMAQRSEENVLALKSVEFTWPEFLGSSEVNVEDFWATMETEVIEQVAFPASIPITKFDAS
VIAPFFPPLMRGAVVVNTEKDKNLDVQPVPGNGSALVRLLQEGTCKLEEMGSYSEEELQQ
LLRQCGVPFGAEDSKDQLCFSLLALYESVQNGARTRQPPPHLTGGKIYKVCPHQVICGSK
YLVRGESARDHVDLLASSRHWPPVYVVDMATQVALCADLCYPELTNQMWGRNQGCFSSPT
EPPVSVSCPELLDQHYTVDMTEAEHSVQHPVTKTATRRIIHAGTQLSPGDSSAGHHSLAL
CPELAPYSTILASITDSKPNSVRQRPIAFDNATHYYLYNRLMDFLTSREIVNRQIHDIVQ
SCQPGEVVIRDTLYRLGVAQIKTETEEEGEEEEVAAVTE
Download sequence
Identical sequences G1PMA7
ENSMLUP00000012026 ENSMLUP00000012026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]