SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012407 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012407
Domain Number 1 Region: 175-560
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.49e-161
Family Myotubularin-like phosphatases 0.000000000000793
Further Details:      
 
Domain Number 2 Region: 49-172
Classification Level Classification E-value
Superfamily PH domain-like 3.32e-44
Family GRAM domain 0.000000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012407   Gene: ENSMLUG00000013626   Transcript: ENSMLUT00000013633
Sequence length 573
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429986:478:51909:-1 gene:ENSMLUG00000013626 transcript:ENSMLUT00000013633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SASTSHSENSVHTKSASVVSSDSISTSADNFSPDLRVLRESNKLAEMEEPPLLPGENIKD
MAKDVTYICPFTVPVRGTLTVTNYRLYFKSMEQDPPFVLDASLGVISRVEKIGGASSRGE
NSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNLPLFAFEYKEVFPENGW
KLYDPLLEYRRQGIPNESWRITKINERYDLCDTYPALLVVPASIPDEELKRVASFRSRGR
IPVLSWIHPESQATITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVN
AVANKAKGGGYESEDAYQNTELVFLDIHNIHVMRESLRKLKEIVYPNIEETHWLSNLEST
HWLEHIKLILAGALRIADRVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGFE
VLVEKEWLSFGHRFQLKVGAEQMQNHADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFL
ITILDHLYSCLFGTFLCNSEQQRVKENLPKRTVSLWSYINSQLEDFTNPLYGSYSNHVLY
PVASMRHLELWVGYYVRWNPCMKPQVCCTIHSR
Download sequence
Identical sequences G1PN96
ENSMLUP00000012407 ENSMLUP00000012407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]