SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012413 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012413
Domain Number 1 Region: 393-615
Classification Level Classification E-value
Superfamily VPS9 domain 6.67e-44
Family VPS9 domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012413   Gene: ENSMLUG00000013630   Transcript: ENSMLUT00000013639
Sequence length 621
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430545:15520:23891:-1 gene:ENSMLUG00000013630 transcript:ENSMLUT00000013639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEAYAEYLRSIHYIQVLLEEVETTQDAGEPVTPDALKMLKLAEQCLERAQSTVAKLGKAC
LKPAMPVAAAGPSPTSRHRRVYSDEGGKLLPFLPPEIFQRLQVVESQSSKKELTPLEEAS
LQNQKLKAAYEARMARLDPSQALQKTSLTLSLQRQMMENLVIAKAREETLQRKMEERRLR
LQEAANRRFCSQVTLTPEEREQRALYAAILEYEQDHDWPKHWKAKLKRSPGDLSLVTGLV
SHLLSVPDHPIAQLLKKLQCAVYRALYHVVSRGAAAAPAPGGCSLPPDAEGLLAPGSRRL
RPSQSLYCMLSPPEPSPAPHPPAGPPTSPPHTHSSPGPPTEGQTAALRGLSHSWCAKDSS
FEDLGTVPGHFREVGPGALGGGTDPQASGVKEEPLLEPLKSIVKDIHNAVDRLLSLTLLA
FEGLNTAVSKDRCLACIEEPFFSPLWPLLLALYRSVYRPREAALSRSMELYSNAPPAALG
IPPKLLPRDPEASGASTYPYDAAAQELGLLVLECCPQKKLDCIVRALRVICACAEGYYWA
QEPAPEARPQPGAAAIGADDLLPILSFVVLRSGLPQLVSECAALEEFIHEGYLIGEGGYC
LTSLQSALSYVELLPRGALGK
Download sequence
Identical sequences G1PNA2
ENSMLUP00000012413 ENSMLUP00000012413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]