SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012866 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012866
Domain Number 1 Region: 375-489
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-36
Family Ankyrin repeat 0.00021
Further Details:      
 
Domain Number 2 Region: 3-70
Classification Level Classification E-value
Superfamily RING/U-box 1.6e-35
Family RING finger domain, C3HC4 0.0000374
Further Details:      
 
Domain Number 3 Region: 523-623
Classification Level Classification E-value
Superfamily BRCT domain 5.96e-22
Family BRCT domain 0.0093
Further Details:      
 
Domain Number 4 Region: 623-728
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000209
Family DNA topoisomerase II binding protein 1, TopBP1 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012866   Gene: ENSMLUG00000014140   Transcript: ENSMLUT00000014144
Sequence length 729
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429770:15474767:15525592:-1 gene:ENSMLUG00000014140 transcript:ENSMLUT00000014144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNSTNILKEPVCLGRCEHIFCSNCVSDCLGAECPVCNTPAWIQDVKINRQLDSMIQLCSK
LRNLLHENELSADLKEETSRKNLFNHAESKKNSIKMWFSPRSKKVRYVVSKVSVQTQPQV
INDENTQQASTYEYVSASPPVDSSARAKKASTRSGKKQKKKTLTKINQMWNLEAGKKDGQ
LDSKEKFKEKLVSFSVQPSVNASPQRNGEIDLLASGSVAEDECFGNLTEVSLPLAEQIES
PEIESRNEVMTPEKNLCENDLSSKNGKRGRHRRLSSPISKKCRNSIPSTSENFVKQTGLS
ENIPLPGSSLQPSTKLKVGDRVRRKTRTILDESMSSSPSTLNSTPPSTLNSTNYGRMLSS
PSAMKLTPGNLTTVKRNHKGETLLHIASIKGDIPSVAYLLQNGSDPNVKDHAGWTPLHEA
CSHGHLQVVELLLQHKALVNTPGYQNDSPLHDAAKNGHLDIVELLLSHGASRNAVNIFGL
RPVDYADSKTMKSLLLPPEKNESSPTRHCSVMHAAQRRDGPLVLIGSGLSSEQQKMLSEL
AAILKAKKCAEFDSTVTHVIISGDTVQSTLKCMLGILNGCWILNFEWVKACLQSKQCEQE
EKYEIPQGPQRSRLNREQLLPKLFDGCYFYFGGIFKHHPKDNLIKLVTAAGGQILRRKPK
PDSDVTQTINTVAYHAKPDSDQRFCTQYIIYEDVSCHRPERVRQGKVWMAPSSWFIDCVI
SFELLPLDS
Download sequence
Identical sequences G1PPD9
ENSMLUP00000012866 ENSMLUP00000012866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]