SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012885 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012885
Domain Number 1 Region: 254-526
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.28e-78
Family Nuclear receptor ligand-binding domain 0.00000000155
Further Details:      
 
Domain Number 2 Region: 202-281
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-29
Family Nuclear receptor 0.0000142
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000012885
Domain Number - Region: 175-215
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 0.0131
Family Hydrophobin II, HfbII 0.014
Further Details:      
 
Domain Number - Region: 118-127
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0418
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012885   Gene: ENSMLUG00000014163   Transcript: ENSMLUT00000014165
Sequence length 532
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430454:321179:326808:1 gene:ENSMLUG00000014163 transcript:ENSMLUT00000014165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAAAGEQQTP
EPEPGETGRDGMGDSGRDSRSPDSSSPNPLSQGAPPHSPPGPPLPPSAAPSLGGSGAPPP
PPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKP
PVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSC
RDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMPV
DRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFS
SLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRVL
TELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPE
QQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
Download sequence
Identical sequences G1PPF3
XP_006105533.1.53796 ENSMLUP00000012885 ENSMLUP00000012885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]