SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012914 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012914
Domain Number 1 Region: 646-890
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-65
Family Nuclear receptor ligand-binding domain 0.000000000241
Further Details:      
 
Domain Number 2 Region: 529-606
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.87e-25
Family Nuclear receptor 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012914   Gene: ENSMLUG00000014191   Transcript: ENSMLUT00000014197
Sequence length 892
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429771:17414588:17707209:-1 gene:ENSMLUG00000014191 transcript:ENSMLUT00000014197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVQLGLGRLYPRPPSKTYRGAFQNLFQSVREVIQTPGSRHPEAVSAAPPGAQLQQQQTS
PRQQQQQGEDGSPQAQSRGPPSYLALEEEQQPSQQQSALAGHPESSCIPEPGVPSAAGKG
LQRQPPAPTEEDDSAAPSTLSLLGPTFPCLSSCSADLKDILSEAGTMQLLQQQQQQQQQQ
QQQQEVVSEGSSCGRAREAAGAPTSSKDSYLGDSSTISDSAKELCKAVSVSMGLGVEALE
HLSPGEQLRGDCMYAPLLGGPPSVRPTPCAQLAECKGSLLDDCPGKGTEETSEYSPFKAV
YPKGLEGENLGCSGSGETGVSGTLELPSTLSLYKSGALEEATTYQSREYYNFPIALAGPP
PPLPAPHPQARIKLENSLDYGSAWAAAAAAQCRYGDLASLHGGGAAGPSSGSPSAATSSS
WHTLFTADESQLYGPCGGGGGGSTGEAGAVAPYGYSRPPQGLSGQEGEFSPSDAWYPGGM
VSRVPYSSPSCVKSEMNPWMESYSGSYGDMRLETAREHVLPIDYYFPPQKTCLICGDEAS
GCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLG
ARKLKKLGNLKLQEEGEASSATSPTEEPTQKLAVSHIEGYECQPIFLNVLEAIEPGVVCA
GHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVF
AMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCM
KALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQ
PIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ
Download sequence
Identical sequences G1PPI1
ENSMLUP00000012914 ENSMLUP00000012914 XP_006082997.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]