SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013546 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013546
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-27
Family SH2 domain 0.00000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013546   Gene: ENSMLUG00000014879   Transcript: ENSMLUT00000014881
Sequence length 127
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429769:13428458:13451824:-1 gene:ENSMLUG00000014879 transcript:ENSMLUT00000014881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGAYCLCVLYQGYIYTYRVSQTD
TGSWSAETAPGVHKRFFRKIKNLISAFQKPDQGIVIPLQYPVEKSSARSTQGTTGRREDP
DVFLKAP
Download sequence
Identical sequences G1PR06
XP_005872771.1.60319 XP_006082194.1.53796 XP_006776096.1.95426 ENSMLUP00000013546 ENSMLUP00000013546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]