SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013695 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013695
Domain Number 1 Region: 375-609
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.24e-64
Family Protein kinases, catalytic subunit 0.00000000092
Further Details:      
 
Domain Number 2 Region: 147-260
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-31
Family SH2 domain 0.000000514
Further Details:      
 
Domain Number 3 Region: 12-137
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-31
Family SH2 domain 0.000000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013695   Gene: ENSMLUG00000015037   Transcript: ENSMLUT00000015040
Sequence length 610
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430213:631:38118:-1 gene:ENSMLUG00000015037 transcript:ENSMLUT00000015040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGDSMAAGVADHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRAHPSPAELCLYHSQESDGLVCLLKKPFHRPPGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISRDESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGRVLHYRIDKDKTGKLSIPDGKKFDTLWQL
VEHYSYKPDGLLRVLTVPCQKIGGQTGNVNFGGRPQLPGANPATWTAGGIISRIKSYSFP
KPGHRKTSSQGTRPESSVTFNPYEPEGAPWPSEREAQREALPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEECNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVSAMLEKGERMGCPGCPREM
YELMTLCWTY
Download sequence
Identical sequences G1PRD5
ENSMLUP00000013695 ENSMLUP00000013695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]