SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013696 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013696
Domain Number 1 Region: 94-353
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-70
Family Nuclear receptor ligand-binding domain 0.0000098
Further Details:      
 
Domain Number 2 Region: 38-114
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.16e-29
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013696   Gene: ENSMLUG00000015036   Transcript: ENSMLUT00000015041
Sequence length 367
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430397:379997:385473:-1 gene:ENSMLUG00000015036 transcript:ENSMLUT00000015041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPQTPGQGGPASTLAQTAGGGQGGPGGPGGDKQQQQQHIECVVCGDKSSGKHYGQFTCEG
CKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAADHGQFAPDQ
PGPPSTATCTLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWA
RNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVA
FMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEE
YVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFN
WPYMAIQ
Download sequence
Identical sequences G1PRD6
ENSMLUP00000013696 ENSMLUP00000013696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]