SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013970 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013970
Domain Number 1 Region: 34-109
Classification Level Classification E-value
Superfamily RING/U-box 0.0000765
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000013970
Domain Number - Region: 4-42
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.025
Family B-box zinc-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013970   Gene: ENSMLUG00000015332   Transcript: ENSMLUT00000015333
Sequence length 312
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430329:306104:310247:1 gene:ENSMLUG00000015332 transcript:ENSMLUT00000015333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLCKCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQSYLQWLQDSDYSSNCRLCNTPL
ASRETTRLVCYDLFHWACLNERAAQLPRNTAPAGYQCPSCSGPIFPPSNLVGPVASVLRE
KLTTVNWARAGLGLPLIDEVVSPEPEPLNTSDFSDWSSFNAASTPAQEEIASTSTAPAFY
SQAPRPPAPPNRPEQHTVIHMGSSEPLTHASAPRKVYDTRDDDRAPGLHRDCDDDKYRRR
PALGWLAQLLRSRDGSRKRPLTLLQRAGLLLLLGLLGFLALLALMSRLGRAAADNDPNLD
PLMNPHIRVGPS
Download sequence
Identical sequences G1PS39
ENSMLUP00000013970 ENSMLUP00000013970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]