SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014049 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014049
Domain Number 1 Region: 74-412
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-82
Family Protein kinases, catalytic subunit 0.00000429
Further Details:      
 
Domain Number 2 Region: 1376-1441
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 
Domain Number 3 Region: 1459-1591
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000308
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000014049
Domain Number - Region: 614-796
Classification Level Classification E-value
Superfamily Tropomyosin 0.000353
Family Tropomyosin 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014049   Gene: ENSMLUG00000015398   Transcript: ENSMLUT00000015418
Sequence length 2052
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429948:1010157:1172155:1 gene:ENSMLUG00000015398 transcript:ENSMLUT00000015418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKFKYGARSQLDAGAAEPIAARASRLNLFFQGKPPLMTQQQMSPLSREGILDALFVLFE
ECSQPALMKMKHVSNFVRKYSNTIAELQELQPSAKDFEVRSLVGCGHFAEVQVVRERATG
DIYAMKVMKKKAVLAQEQVSFFEEERNILSQSTSPWIPHLQYAFQDKNNLYLVMEYQPGG
DLLSLLNRYEDQLDENMIQFYLAELILAVHSVHLMGYVHRDLKPENILIDRTGHIKLVDF
GSAAKMNSNKMVNAKLPIGTPDYMAPEVLTVMNGDGKGVYSLDCDWWSVGVIAYEMVYGR
SPFTEGTSARTFNNIMNFQRFLKFPDDPKVSSELLDLIQSLLCGQKERLKFEGLCCHPFF
SKIDWNNIRNSPPPFVPTLKSDDDTSNFDEPEKNSWVSSSPCQLNPSGFSGEELPFVGFS
YSKALGILGRSESVVSGLDSPAKTSSMEKKLLIKSKELQDSQDKCHKMEQEMTRLHRRVS
EVEAVLSQKEVELKASETQRSLLEQDLATYITECSSLKRSLEQARMEVSQEDDKALQLLH
DIREQSRKLQEIKEQEYQAQVEEMRLMMNQLEEDLVSARRRSDLYESELRESRLAAEEFK
RKATESQHKLMKAKDQGKPEVGEYSKLEKINAEQQLKIQELQEKLEKAVKASTEATELLQ
NIRQAKERAERELEKLQNREDSSEGIKKKLMEAEERRHSLENKVKRLETMERRENRLKDD
IQTKSQQIQQMADKILELEEKHREAQISAQHLEVHLKQKEQHYEEKIKVLDNQIKKDLAD
KESLENMMQRHEEEAHEKGKILSEQKAMINAMDSKIRSLEQRIVELSEANKLAANSSLFT
QRNMKAQEEMISELRQQKFYLETQAGKLEAQNRKLEEQLEKISHQDHSDKNRLLELETRL
REVSLEHEEQKLELKRQLTELQLSLQEREAQLTALQAARAALESQLRQAKTELEETTAEA
EEEIQALTAHRDEIQRKFDALRNSCTVITDLEEQLNQLTEDNAELNNQNFYLSKQLDEAS
GANDEIVQLRSEVDHLRREISEREMQLTSQKQTMEALKTTCTMLEEQVMDLEALNDELLE
KERQWEAWRSVLGDEKSQFECRVRELQRMLDTEKQSRARADQRITESRQVVELAVKEHKA
EILALQQALKEQKLKAESLSDKLSDLEKKHAMLEMNARSLQQKLETERELKQRLLEEQAK
LQQQMDLQKSHIFRLTQGLQEALDRADLLKTERSDLEYQLENIQVLYSHEKVKMEGTISQ
QTKLIDFLQAKMDQPAKKKKVPLQYNELKVALEKEKARCAELEEALQKTRIELRSAREEA
AHRKATDHPHPSTPATARQQIAMSAIVRSPEHQPSAMSLLAPPSSRRKESSTPEEFSRRL
KERMHHNIPHRFNVGLNMRATKCAVCLDTVHFGRQASKCLECQVMCHPKCSTCLPATCGL
PAEYATHFTEAFCRDKMNSPGLQAKEPGSSLHLEGWMKVPRNNKRGQQGWDRKYIVLEGS
KVLIYDNEAREAGQRPVEEFELCLPDGDVSIHGAVGASELANTAKADVPYILKMESHPHT
TCWPGRTLYLLAPSFPDKQRWVTALESVVAGGRVSREKAEADAKLLGNSLLKLEGDDRRS
ALALLPLQVVLVGTEEGLYALNVLKNSLTHVPGIGAVFQIYIIKDLEKLLMIAGEERALC
LVDVKKVKQSLAQSHLPAQPDISPNVFEAVKGCHLFAAGKIENGLCICAAMPSKVVVLRY
NENLSKYCIRKEIETSEPCSCIHFTNYSILIGTNKFYEIDMKQYTLEEFLDKNDHSLAPA
VFASSSHSFPVSIMQVNSAGQREEYLLCFHEFGVFVDSYGRRSRTDDLKWSRLPLAFAYR
EPYLFVTHFNSLEVIEIQARSALGTPARAYLEIPNPRYLGPAISSGAIYLASSYQDKLRI
ICCKGNLVKESGTDHHRGPSTSRSSPNKRGPPTYNEHITKRVASSPAPPEGPSHPREPST
PHRYREGRTELRRDKSPGRPLEREKSPGRMLSTRRERSPGRLFEDSSRGRLPAGAVRTPL
SQVNKVWDQSSV
Download sequence
Identical sequences G1PSA9
ENSMLUP00000014049 ENSMLUP00000014049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]