SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014212 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014212
Domain Number 1 Region: 93-212
Classification Level Classification E-value
Superfamily PX domain 7.19e-16
Family PX domain 0.0031
Further Details:      
 
Domain Number 2 Region: 293-347
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000216
Family SAM (sterile alpha motif) domain 0.0052
Further Details:      
 
Domain Number 3 Region: 893-923
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000046
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014212   Gene: ENSMLUG00000015605   Transcript: ENSMLUT00000015605
Sequence length 947
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429965:593138:656580:-1 gene:ENSMLUG00000015605 transcript:ENSMLUT00000015605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNHPAFSFHQKQVLRQELTQIQSSLSGGSGGGHGGKSALPTCPSCHKVTPRTETPVTS
VSNSLENALRTSAHSTEESLPKRTVGKHSKVSVEKIDLKGLSHKKNERNVECSFEVLWSD
SSVTSVTKSSSEVTEFISKLSQLYPEENLEKFIPCLAGPDSFYVERNHMDLEADLRYLAS
LPSHVLKNDHVKKFFSTSSPTQQLQSPSPGNLSLSKVGTMMGVSGRPVCGVAGIPSSQSG
TQHHMQHSAGAAALPHCSHTGGGGSALPYRTQMDTSPAILMPSSLQTPQTQEQNGILDWL
RKLRLHKYYPVFKQLTMEKFLSLTEEDLNKFESLTMGAKKKLKTQLELEKEKSEKRCLNP
SAPPPVTSSGVARVPPTSHVGPVQNVRSPHAAVLRVEVEQPPHQTAREGSSSECSSSSPS
PMGVQAREESSDSAEENDRRVEMHMEGSDKEKPVMLLNHFTSSSARPTAQVLPVQNEAGS
NPSGHHPLPPQMMTAASHIAPIRMLNSVHKSERGGTDMKLLSSSMHSLLSLEERNKVSGP
RSGIKVDKSFGNAMMDVLPTSAPHQPMQVLSGLAESSSVSPTISFGPRTKVVHASALDRV
MKPAQQPALVVETSTAAVGTSSTVFHVARPPIKLLVSSSVPADSVISGQTSCSNNVQISV
PPAIINPRTALYTANTKAAFSAMSSVPVGPLQGSFCANSNTASSSSHPSPSFPNMATVPS
CPAPSSSPALSSVPESSFYSSSSSSSGSGSPGNIPASAQNHHHHHHHQQPSAPPQPSPGP
PPGCVVCTSCGCSGSCGSGGLTVSYANYFQHPFSGPSVFPFPFLPFSPVCGSGYVGTQQY
GNSAFPVVHSPYGSSVPAEPVLGSQSTFTVPPMQSFMAGAAGVYQAQGLVGSSNGSSHKK
SGNLSCYNCGATGHRAQDCKQPSMDFNRQGTFRLKYAPPAESLDSTD
Download sequence
Identical sequences G1PSQ2
XP_014318593.1.53796 XP_014318597.1.53796 ENSMLUP00000014212 ENSMLUP00000014212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]