SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014236 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014236
Domain Number 1 Region: 358-523
Classification Level Classification E-value
Superfamily PH domain-like 3.28e-54
Family Phosphotyrosine-binding domain (PTB) 0.000000311
Further Details:      
 
Domain Number 2 Region: 538-660
Classification Level Classification E-value
Superfamily PDZ domain-like 9.73e-19
Family PDZ domain 0.0000977
Further Details:      
 
Domain Number 3 Region: 652-734
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000263
Family PDZ domain 0.0000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014236   Gene: ENSMLUG00000015628   Transcript: ENSMLUT00000015631
Sequence length 743
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430514:32840:51349:1 gene:ENSMLUG00000015628 transcript:ENSMLUT00000015631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APAMAHRTHQSTASSMLDHRARPGPVPPSQEPEGPDAELPLEGYVAPGLVRPESPPPPER
GCPDHSPDHSPDGDSSSDYVNNTSEEEDYDEGLPEEEGVTYYIRYCPEDEQLEGADCRGR
GPSLETDECKPVEDWTDSVGHGHEGGPGYPDGRLPVPEDEASVLEAPDQEEGLHYCPGEE
ESYRDYYPPEANGNAGGASPYHPRRRGGDLEDQEEDIDQIVAEIKMSLSMTSIASAGEAS
PEHAPVRGPELGPGDPTEASLPGEAGRGPSRHEGRPTSLSLPPQARLPGDPPRGLKTKGR
TPEERPTWPQEQVCNGVEPRRQQRSDLNGPVDNNNVSETKKAASFPSFVAVPGPCEPEDL
IDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKKKAHSEGDAQTL
TEVDLFISTQRTKVLNANTQETMMDHALRTISYIADIGNIVVLMARRRMPRAASQDCIET
TPGAPEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKDYSDI
ISSQEMYNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGSILPTVILANMLNGGPA
ARSGKLSIGDQIMSIDGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVTTVLIKRPD
LKYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATAHEKIVQALSNSVGE
IHMKTMPAAMFRLLTGQETPLYI
Download sequence
Identical sequences G1PSS4
ENSMLUP00000014236 ENSMLUP00000014236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]