SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014372 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014372
Domain Number 1 Region: 248-335,541-578
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 6.02e-44
Family Inhibitor of apoptosis (IAP) repeat 0.00000609
Further Details:      
 
Domain Number 2 Region: 160-252
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.96e-32
Family Inhibitor of apoptosis (IAP) repeat 0.0000879
Further Details:      
 
Domain Number 3 Region: 22-104
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 5.5e-30
Family Inhibitor of apoptosis (IAP) repeat 0.00035
Further Details:      
 
Domain Number 4 Region: 439-535
Classification Level Classification E-value
Superfamily DEATH domain 2.12e-20
Family Caspase recruitment domain, CARD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014372   Gene: ENSMLUG00000015772   Transcript: ENSMLUT00000015774
Sequence length 603
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429906:2713124:2723313:1 gene:ENSMLUG00000015772 transcript:ENSMLUT00000015774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLVENSEFLSKLMKSANMSEMKYDFSCELYRMSTYSTFPAGVLVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKQGDKPIEKHKKLYPSCVFLQKLNSGNISGATSPLNLPSSGTNS
THSVFPSSENSGYFSGSYSSFPSSPVNSEPNHDVSALRSPNHCIMNTEHARLLTFQTWPL
TFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHLRHFPHCPFLESRPQD
TSRYSVSNLSMQTQAARFRTFCNWPSSVGVHPKQLASAGFYYMGHNDDVKCFCCDGGLRC
WESGDDPWVQHAKWFPRCEYLIRVKGQEFISRVQANYPHLLEQLLSTSENPEDENAELPI
IHYGPGENHSEDAVMMNTPVVTAALDMGFSRRLVKQTVQSKILTTGENYKIVSDLVLDLL
YAEDEIREEEKERATEEEESDDLSYIRKNRMALSQHLTCVVPILDSLLIAGVIHEQEHDI
IRLKTQTTLQARELIDTIIVKGNFAATVFRNSLQENDPTLYKRLFVQQDIKYVPTENVSD
LPIEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRGTIKGTVRT
FLS
Download sequence
Identical sequences G1PT39
XP_014316263.1.53796 ENSMLUP00000014372 ENSMLUP00000014372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]