SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014380 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014380
Domain Number 1 Region: 264-351,559-596
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.31e-44
Family Inhibitor of apoptosis (IAP) repeat 0.00000238
Further Details:      
 
Domain Number 2 Region: 177-252
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.49e-31
Family Inhibitor of apoptosis (IAP) repeat 0.0000787
Further Details:      
 
Domain Number 3 Region: 39-116
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 3.79e-30
Family Inhibitor of apoptosis (IAP) repeat 0.00031
Further Details:      
 
Domain Number 4 Region: 457-554
Classification Level Classification E-value
Superfamily DEATH domain 4e-22
Family Caspase recruitment domain, CARD 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014380   Gene: ENSMLUG00000015779   Transcript: ENSMLUT00000015784
Sequence length 621
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429906:2737449:2757187:1 gene:ENSMLUG00000015779 transcript:ENSMLUT00000015784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
THAQNYLPMTCPRSLISKKTIMEDSTILSNWTIDDKHKMKYDFSCELYRMSTYSTFPTGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKQGDNPIEKHKQLYPSCSFIQNLVSVT
GLESTFKTTSPVRNSLTHSLSPTLEQRGSFSGSYPNLSSNPIHSRAVEDLSSLRTNPYSY
AMSTEQARLLTYHLWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSE
HRRHFPNCPFLENSLDTLRFSISNLSMQTHAARLRTFMYWPSNVPVQPEQLASAGFYYVG
RNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQGFVDEIQARYPHLLEQL
LSTSDTPGDENADPPIVHFGPGESSSEDAVMMDTPVVKAALEMGFSRSLVKQTVQSKILT
TGENYKTVNDIVSALLHAEDENRQEEKERQTEEMASDEDDLSLIRKNRMALFQQLTCVLP
ILDNLLKANIINKQEHDIIKQKTQIPLQARELIDTVLVKGNAAANIFKNCLKEIDSTLYK
NLFVEKNMKYIPTEDVSGLSMEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCQECAP
SLRKCPICRGIIKGTVRTFLS
Download sequence
Identical sequences G1PT46
ENSMLUP00000014380 ENSMLUP00000014380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]