SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014505 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014505
Domain Number 1 Region: 456-576
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-27
Family Cadherin 0.0022
Further Details:      
 
Domain Number 2 Region: 123-234
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-24
Family Cadherin 0.0022
Further Details:      
 
Domain Number 3 Region: 230-350
Classification Level Classification E-value
Superfamily Cadherin-like 1.04e-17
Family Cadherin 0.0068
Further Details:      
 
Domain Number 4 Region: 565-674
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000357
Family Cadherin 0.0017
Further Details:      
 
Domain Number 5 Region: 36-130
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000103
Family Cadherin 0.0081
Further Details:      
 
Domain Number 6 Region: 343-460
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000528
Family Cadherin 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014505   Gene: ENSMLUG00000015917   Transcript: ENSMLUT00000015925
Sequence length 853
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430066:1368289:1389390:-1 gene:ENSMLUG00000015917 transcript:ENSMLUT00000015925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SWAKVPLTPGSHLLCVFFPAKVNFAPHFFGNGNLGLFSLPEDTPVGSHVYTLNGTDPEGE
PVSYHISFDPSTRSVFSVDPNFGNITLIEELDREREDEIEAIISISDGLNLVSEKVVILV
TDVNDEAPRFLQEPYTVQIPEDTPAGSSIFEVRAVDKDTGSGGSVTYSLQNTLATQFTVD
RHSGVLHLRAGSTLDYETAQAHFVTVVAQDGGGRLRGAAVVFSATTTVTVSVEDVQDVGP
VFVGTPFRGCVYEDTIPGSEVLTVVAMDGDRGKPNRLLYSLVNGSDGAFDINVTSGAIVV
TQSPAQLRREVYELHVQVTEVSAAGSPAAQATVPVTIRLVDLNNHPPTFYGESGPQTRFE
LSLSEHPPPGEILRGLKVTVKDLDQGANAKFALRLVGLEDAFRVVPQTALKEAQVTVLAE
NSAAIDFEKFRVLTFQLLATEVDTAEKFSATADVVVQLLDSNDNAPQFTSPHYVARVPED
APGGSTVVAVRAVDLDTGPWGTVTYSIYGPGADLFQVHSSTGVICTQPWASLDAEATARY
SFHVRAEDTGGRHGLAKVTVLLLDVNDHPPQFGQSIQEKTMVLGTPVRIKATDLDAEAPN
NLVDYSITHAEPASVFDIDARTGEIRLKSSIRSLDALRSITHNGDCTWALEVQAKDRGSP
SFSTMAVLRIDITDAETLPRSPIDAFLMQTRDDPAKAVGMLAGAMAITVAITALVSTATF
WRNKKSNKVLPVRRVLRRRPCPAPRAAHIKWLKCNRTKAAAKFVLKEDPPSENCNGSLGS
PPTPRAPVPPPLPRVAPGPGAAPWTVPTVSGSLTSLQPQGSPKPSASGSPIQSALVSELR
QQFEKRRADKVHF
Download sequence
Identical sequences G1PTF4
ENSMLUP00000014505 ENSMLUP00000014505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]