SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014702 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014702
Domain Number 1 Region: 79-163
Classification Level Classification E-value
Superfamily HMG-box 4.58e-23
Family HMG-box 0.00022
Further Details:      
 
Domain Number 2 Region: 4-82
Classification Level Classification E-value
Superfamily HMG-box 1.96e-19
Family HMG-box 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014702   Gene: ENSMLUG00000016136   Transcript: ENSMLUT00000016137
Sequence length 186
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429898:2059546:2060103:-1 gene:ENSMLUG00000016136 transcript:ENSMLUT00000016137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKEIQLRPKVNVSSYIHFLLNYRNKFKEQQPNTFLGFKEFSRKCSEKWKSISKHEKSKY
EALAKLDKARYQEEMMNYVGKKKKRRKRDPLAPRRPPSSFLLFCQDHYAQLKRENPTWSV
VQVAKASGKLWAAKSDMEKQLYEERAAILRAKYYEELKVYREQRMARKNLRRSARNPCRG
CRQAEA
Download sequence
Identical sequences G1PTX3
ENSMLUP00000014702 ENSMLUP00000014702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]