SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014933 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014933
Domain Number 1 Region: 16-114
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014933   Gene: ENSMLUG00000016390   Transcript: ENSMLUT00000016386
Sequence length 427
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429882:1892580:1908239:-1 gene:ENSMLUG00000016390 transcript:ENSMLUT00000016386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGVKEAGEKPQRARTADKAGWIKKSSGGFLGLWKDRYLLLCQAQLLVYENEDEQKCVETV
ELGSYEKCQDLRALLKRKHRFILLRSPGNKVSNIKFQAPNGEEKESWIKALNEGISRGKN
KAFDEIKVDKSCALEHVTRNRVRGGQQRRPPTRIHLKEVASAASDGLSRLDLDALDSRPP
VLTPGNDVNAAQPREALRPLMPPAKPSPAPEVTVLGDRGETPVGERAPTPVSASSEAQPE
SQEDSETAVGEDSSSEQLPRVLPEKLKVSWDNSSPEEPPVPESAEPPQVPCSETSEASAK
EGGKPPTPPPKILSELRASMIGVEASGPARSPGASETSAPGSAQVSVNXQLEVQVASEQT
EPLLNKMLASEPAPVSAETLLSEAVEQLRQATQVLQEIRDLGDLSQEAPGLREKRKELVT
LYRRSAP
Download sequence
Identical sequences G1PUH5
ENSMLUP00000014933 ENSMLUP00000014933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]