SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015073 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015073
Domain Number 1 Region: 36-149
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-36
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000432
Further Details:      
 
Domain Number 2 Region: 243-327,354-374
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.57e-21
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 433-495
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000000262
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015073   Gene: ENSMLUG00000016537   Transcript: ENSMLUT00000016540
Sequence length 507
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429963:781575:789898:1 gene:ENSMLUG00000016537 transcript:ENSMLUT00000016540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMSGGPVGGRPGGRGTQAVQQNIPSTLLQDHENQRVFDMLGRKCWTLATTVIQLYMAMPP
GAERWTKKHCGAVCFVKDNPQKSYFIRLYSLQTGLLLWEQELYSQLVYSTPTTFFHTFAG
DDCQVGLNFADESEAQAFQALVQEKIQKRNQRQSGDRRQLPPPPAPVNEERRGGFPPLPS
HPGGDQGGPAAGSLSLGMGTVDIQNPDITSSRYRGLPVPGPGPADKKRSGKKKIRKADIG
APSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGG
LEAVRQEMRRQEPLPPPPPPSRGGNQPPRPPTVGSNKGRSGPLPPVPLGGVPPPPPPTPR
GPPPPGRGGPPPPPPPATGRSGPPPPPLPGAGGPPMPPPPPPPPPPPPPSSGDVPVPPPV
PPTLGPVGGLAPVGGRGALLDQIRQGIQLNKTPGASESSALQPPPQSSEGLVGALMHVMQ
KRSKAIHSSDEGEDQAGDDEEDDEWDD
Download sequence
Identical sequences G1PUU9
ENSMLUP00000015073 ENSMLUP00000015073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]