SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015350 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015350
Domain Number 1 Region: 230-350
Classification Level Classification E-value
Superfamily Cadherin-like 4e-31
Family Cadherin 0.0015
Further Details:      
 
Domain Number 2 Region: 443-565
Classification Level Classification E-value
Superfamily Cadherin-like 3.66e-28
Family Cadherin 0.0032
Further Details:      
 
Domain Number 3 Region: 344-447
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-24
Family Cadherin 0.003
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-22
Family Cadherin 0.0061
Further Details:      
 
Domain Number 5 Region: 559-671
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000157
Family Cadherin 0.0021
Further Details:      
 
Domain Number 6 Region: 30-123
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000113
Family Cadherin 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015350   Gene: ENSMLUG00000016845   Transcript: ENSMLUT00000016842
Sequence length 799
Comment pep:novel scaffold:Myoluc2.0:GL429795:4784564:4792872:-1 gene:ENSMLUG00000016845 transcript:ENSMLUT00000016842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVITPEGRLGSRCLLLSLMFLAVWEAGSGQVLYSVPEEAKHGTFVGRIAQDLGLELAELV
PRLFRVASKDRGDLLEVNLQNGILFVNSRIDREELCGRSLECSIHLEVVVERPLQVFHVE
VEVKDINDNPPVFPVKEQRVLIYESRLPDSLFPLEGASDEDVGVNSILTYKLSSSEYFSL
DVKTNSDDNTQIGLVLRKSVDREETPTHNLLLTATDGGKPELTGSVQVLVTVMDVNDNAP
RFSQSEYEVRIFENSDNGTIVIRLNASDPDEGINREISYSFNSFVPPMVIDQFSIDSNSG
EIKIRKNLDFEKVKSYKIRIDATDRGHPPMAGHCTVLVKVLDENDNSPEVVVTSLSLPVL
EDAQLGTVIALISVSDRDSGANGQVTCSLTPNVPFKLVSTFKNYYSLVLDSALDRESVAN
YELVLTARDGGSPSLSSTASLSVEVADVNDNAPLFAQPEYTVFVKENNPPGCHIFTVSAR
DMDAQENALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDA
GVPPLGSNVTLQVFVLDENDNAPALLPPAPGGPGGAVSELVSGSVGAGHVVAKVRAVDAD
SGYNAWLSYELLPAAGGARSPFRVGLYTGEISTTRALDEADSPRQRLLVLVKDHGEPALA
VTATVLLSLVDSSQAPKTSLRVSSGAMSAETALVDVNVYLIIAICAVSSLLVLSLLLYTA
LRCWALPTQGVCGPGKPVLVCSSAVGSWSYSQQRRQRVCSGEGPPKTDLMAFSPSLPPCP
VPEVETEGQSIGGDHSRKV
Download sequence
Identical sequences G1PVI4
ENSMLUP00000015350 ENSMLUP00000015350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]