SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016012 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016012
Domain Number 1 Region: 628-795
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-49
Family SPRY domain 0.0000184
Further Details:      
 
Domain Number 2 Region: 334-420
Classification Level Classification E-value
Superfamily RING/U-box 3.3e-19
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 2-80
Classification Level Classification E-value
Superfamily RING/U-box 2.59e-18
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 4 Region: 92-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.17e-17
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Domain Number 5 Region: 422-482
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.27e-16
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016012   Gene: ENSMLUG00000017560   Transcript: ENSMLUT00000017563
Sequence length 804
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430483:153103:192301:1 gene:ENSMLUG00000017560 transcript:ENSMLUT00000017563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VREEATCSICLHLMAEPVSISCGHSYCQACLLRFMGPSSSPRRQQYRETFSCPQCRASCH
RGSLRPNKQLGSLIAALREQEQEQQQQEQEQEQELSCQEHGERLHLFCEDDGQLICWRCE
RDGQHKGHNTVLVEDASTGYREKLQEAVRKLRQLEEECTNQKAITATQIAQWEEKIEAQR
QKIQADFQKLRSFLREEERSYLWRLESERARTLKRLRGTEANLGHFVNPCALREIVKKME
QYCQGCTLRPVLLSSYKHTTDEPLGSALHTPVAQPSQVQTLRAQPSLLQKLRANSGFLPK
PSIAPPSTTESAVGASGSGIAAFGRGMASASASKKMWEEATCSICLHLMAEPVSISCSHS
YCQACLLRFVGPPSSPRSQQNTDTFSCPQCQAPLQRGSLRPNKQLGSLIAALREQEQEQE
QEQELSCEEHGERLHLFCEDDGQLICWRCERHGQHKGHNTVLVEDVSPGYREKLQEAVRK
LRQLEEECTNQKAFTAKQITQWKEKIEAQRQKIQVDFQNLHSFLREEERSYLWRLESEEQ
RTLQRLRGSEADLGQQSLELESHILELEERCQGSFQKLLQIKANLFYFCGLWQQVQGPDY
KGEGLGAVCSPGGLSRQLLSSVPSIYIYIYILGVTLDPETAHPELIVSQDQRQVTRGPQR
EADTSPWRFMASPCILGRQSFASGRRYFEVDVGEGTGWDVGVCLESVQRLGGTTQRPETG
FWALRLGAKDGYVALTWPRTPLRLQERPLVVGVLLDCEVGLVSFYSGTSGSHMFTFPRAA
FPDALRPYLQVYPYSPLFLPSPDE
Download sequence
Identical sequences G1PX55
ENSMLUP00000016012 ENSMLUP00000016012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]