SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016088 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016088
Domain Number 1 Region: 240-503
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.31e-82
Family Nuclear receptor ligand-binding domain 0.000000000169
Further Details:      
 
Domain Number 2 Region: 136-221
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.2e-28
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016088   Gene: ENSMLUG00000017638   Transcript: ENSMLUT00000017643
Sequence length 505
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429775:13269542:13332214:-1 gene:ENSMLUG00000017638 transcript:ENSMLUT00000017643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGETLGDSLIDPESDSFAGTLSASTSQEITMVDTEMPFWPTNFGISSVDLSVMDDHSHAF
DIKPFTTVDFSSISTPHYEDIPFARADPMVADYKYDLKLQDYQNAIKVEPASPPYYSEKA
QLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKMNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY
Download sequence
Identical sequences G1PXC2
ENSMLUP00000016088 ENSMLUP00000016088 XP_005870103.1.60319 XP_006083889.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]