SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016095 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016095
Domain Number 1 Region: 206-445
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-70
Family Nuclear receptor ligand-binding domain 0.000000000815
Further Details:      
 
Domain Number 2 Region: 95-181
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-28
Family Nuclear receptor 0.0000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016095   Gene: ENSMLUG00000017646   Transcript: ENSMLUT00000017650
Sequence length 447
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429864:3036021:3041562:-1 gene:ENSMLUG00000017646 transcript:ENSMLUT00000017650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWLEAPVPNVSPDSDSAVELWEPDAQDANSRALRGSNCILREEASMPQSAGGTSGAGL
EVAVPTVPGMEVLPESTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGARYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAQATSVPPRASSPPQVLPQLSPEQLGMIEKLVAAQQQCNRRSFSDQLRVTPWPM
APDPQSWEARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSTIEVMLL
ETSRRYNPESESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDPLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences G1PXC9
ENSMLUP00000016095 ENSMLUP00000016095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]