SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016141 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016141
Domain Number 1 Region: 40-281
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.78e-53
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 280-322
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000034
Family SOCS box-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016141   Gene: ENSMLUG00000017697   Transcript: ENSMLUT00000017701
Sequence length 323
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429816:4559336:4583158:1 gene:ENSMLUG00000017697 transcript:ENSMLUT00000017701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGSLFYGFKNIFITMFATFLFFKLLIKVFLALLTHFYVVKGNRKEAARIAEEIYGGIS
DCWADRSPLHEAAAQGRLLALKTLIAQGANVNLVTINRVSSLHEACLGGHVACAKALLEN
GAKVNAVTVHGATPLFSACCSGSAACVNLLLEFGAKAQLEVHLASPIHEAVKRGHRECME
ILLANNVNIDQEVPQLGTPLYVACTHQRVDCVKKLLELGASVDHGHWLDTPLHAAAKQSS
VEVIHLLIDYGANLKCRNAQGKSALDLAAPKSRVEQALLLWEGPPALSQLCRLCIRKCLG
RACHQSIHKLHLPEPLQRFLLYQ
Download sequence
Identical sequences G1PXH2
ENSMLUP00000016141 ENSMLUP00000016141 XP_006088647.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]