SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016206 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016206
Domain Number 1 Region: 112-172,293-376
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.76e-32
Family Regulator of G-protein signaling, RGS 0.0076
Further Details:      
 
Domain Number 2 Region: 372-510
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.42e-28
Family Regulator of G-protein signaling, RGS 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016206   Gene: ENSMLUG00000017763   Transcript: ENSMLUT00000017767
Sequence length 662
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430122:778293:853655:1 gene:ENSMLUG00000017763 transcript:ENSMLUT00000017767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAGPSPRQSPRALRPDPGPAMSFFRRKVKGKEQDKTSDAKTVKASNPIYSPQKSTKNH
ALLEAAGPSHIAINAISANMDSFSSSRTATLKKQPSHMEAAHFGDLGRSCLDYQVQEAKS
SLSKTLEQVLHDTIVLPYFIQFMELRRMEHLVKFWLEAESFHSTTWSRIRAYSLSTVKQS
SLAEPVSPSKKQETAAPFVTESLDKRLEDSSSAQLLVTQSEESDLNNRTSNTQNRLLLSE
ECDSAHSLHLEMARREAHQLSMETQESSPRLTVASRNSLSSPLKELSGKLMKSIEQDAVN
TFTKYISPDAAKPIPITEAMRNDIIAKICGEDGQVDPNCFLLAQSVVFSAMEQEHFSEFL
RSHHFCKYQIEVLTSGTVYLADILFCESALFYFSEYMEKEDAVNVLQFWLAADNFQSQLA
AKKGQYDGQEAQNDAMILYDKYFSLQATHPLGFDDIVRLEIESNICREGGPLPNCFTTPL
RQAWTTMEKVFLPGFLSSNLYYKYLNDLIHSVRGDEFLGGNVSLTAHGSVGAPDDSHQGG
SDSSASQSSMKKASVKILKNFDEAIIVDAASLDPESLYQRTYAGKMTFGRVSDVGQFIRE
SEPEPDVKKSKGSMFSQAMKKWVQGNTDEAQEELAWKIAKMIVSDVMQQAQYDQPLEKST
KV
Download sequence
Identical sequences G1PXM8
ENSMLUP00000016206 ENSMLUP00000016206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]