SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016445 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016445
Domain Number 1 Region: 215-336
Classification Level Classification E-value
Superfamily Cadherin-like 2.75e-31
Family Cadherin 0.0006
Further Details:      
 
Domain Number 2 Region: 427-551
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-30
Family Cadherin 0.0018
Further Details:      
 
Domain Number 3 Region: 326-430
Classification Level Classification E-value
Superfamily Cadherin-like 2.75e-24
Family Cadherin 0.0043
Further Details:      
 
Domain Number 4 Region: 112-219
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-22
Family Cadherin 0.0085
Further Details:      
 
Domain Number 5 Region: 542-652
Classification Level Classification E-value
Superfamily Cadherin-like 8.82e-18
Family Cadherin 0.0011
Further Details:      
 
Domain Number 6 Region: 16-110
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000257
Family Cadherin 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016445   Gene: ENSMLUG00000028837   Transcript: ENSMLUT00000024862
Sequence length 756
Comment pep:novel scaffold:Myoluc2.0:GL429795:4390611:4396672:-1 gene:ENSMLUG00000028837 transcript:ENSMLUT00000024862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLFLFLLPLFCGALSEQIRYSIPEEMARGSVVGNLAKDLGLRVRDLLTRNLRVSAEKQYF
AINTENGNLLVSDRIDRESLCPQNPVCVVPLEIVAENPLNVFHVNVMIEDINDNPPHFPQ
NSTVLQINELATPGTRFDLESAIDADVGPHSLQSYQLSYNEHFSLMVKDKAEGKNAPELV
LERPLDREQQSSHLLVLTAVDGGDPVRTGTTQIRIEVTDANDNAPVFSQDVYRVSLPENL
PPGTSVLKVTATDQDEGINAEITYSFKIPGDVGSTFTLDHQSGEIKSKNPIDFEISSSYT
IIMEAKDGGGMATKCKIILEILVLDVNDNAPEVLVTSLSSSLMENAPKGTLVALLNVNDQ
DSGENGQVVCFIQENLPFKLEKSYGTYYSLVTDTPLDRELVPSYNITVTATDRGRPPLST
KTHILLNVADTNDNPPAFSQAFYTAYIAENNPRGASIISVTAHDPDYGENAQVTYSLVED
TVQGAPLSSYISINSDTGVLYALCSFDYEQFRDLQLQVMAQDSGDPPLSSNVSLSLFVLD
QNDNTPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEP
GLFAVGLHTGEVRTARALLDRDSLKQSLVVAVQDHGQPPLSATVTLTVAVADSIPDVLAD
LSSLESPANPEDSGLTLYLVVAVAAVSCVFLAFVIMLLALRLRCWHKLRLLQAPGSGFAG
VPASHFVGVDGVQAFLQTYSHEVSLTADSGKSHLIF
Download sequence
Identical sequences G1PYB3
ENSMLUP00000016445 ENSMLUP00000016445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]