SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016714 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016714
Domain Number 1 Region: 330-399
Classification Level Classification E-value
Superfamily Immunoglobulin 8.78e-19
Family I set domains 0.0007
Further Details:      
 
Domain Number 2 Region: 38-138
Classification Level Classification E-value
Superfamily Immunoglobulin 3.19e-17
Family V set domains (antibody variable domain-like) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016714   Gene: ENSMLUG00000026579   Transcript: ENSMLUT00000025546
Sequence length 408
Comment pep:novel scaffold:Myoluc2.0:GL431108:37225:43845:1 gene:ENSMLUG00000026579 transcript:ENSMLUT00000025546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESPSASSHRGLVPWQGLLLAISLLTFWSPPTTAQLAIVPTNAAEGKDVLLRIRNKPPDA
VGFLWYRGEGARSQRNIASIVVDLRVHALGPAYSGREKVNSDGSMLLKRVTRKDTGYYTI
VARLRDSKKEIGFGQLRVYHTELIALDSAPSPSASHSGLGLGIYCRTHTVETNFLRSEFP
SQIPALQTFSTERRASLIGVTQQSQGPIRCLWFPRPTIGSDPSFLGVLSSEETPNTSGSQ
GNTLRLDNGGLCSWKEWSPVSQAVSWSVKIRKKSGVVSVSQSLWKTQRYHTGQFSLSPTP
NITSNNSNLAHTLCVSAEPVRVPTLLASNTTVMEHKDSVVLTCYTNAVSTQWFFNGMNLR
QTERKKLSWNNRTLTIDPVRREDAGNYQCEVSNPISSTESEPVELDVK
Download sequence
Identical sequences G1PZ32
ENSMLUP00000016714 ENSMLUP00000016714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]