SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016900 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016900
Domain Number 1 Region: 84-110,141-380
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.59e-63
Family Nuclear receptor ligand-binding domain 0.00000000234
Further Details:      
 
Domain Number 2 Region: 31-109
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.57e-24
Family Nuclear receptor 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016900   Gene: ENSMLUG00000022851   Transcript: ENSMLUT00000022900
Sequence length 400
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429906:1773222:1849516:-1 gene:ENSMLUG00000022851 transcript:ENSMLUT00000022900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVYPPYLNYLSSRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKR
AMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVMRALDA
VTLPQTVGIPNESQALSQRISFSPSQDLQLVPSLINLLMNIEPDVVYAGHDNSKPDTSSS
LLTSLNQLAERQLLSVVKWSKALPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSG
KMLYFAPDLIINEQRMKELSFYSLCLTMWQIPQEFVKLQLSHEEFLCMKVLLLLNTIPLE
GLRSQNQFDEMRASYIRELIKAIGLRQKGVVSSSQRFYQLTKFLDNLHDLVKQLHLYCLN
TFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKHLLFHKK
Download sequence
Identical sequences G1PZL8
ENSMLUP00000016900 ENSMLUP00000016900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]