SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017523 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017523
Domain Number 1 Region: 16-170
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.34e-48
Family Cyclophilin (peptidylprolyl isomerase) 0.00000071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017523   Gene: ENSMLUG00000030572   Transcript: ENSMLUT00000024670
Sequence length 171
Comment pep:novel scaffold:Myoluc2.0:GL429767:50513893:50514640:1 gene:ENSMLUG00000030572 transcript:ENSMLUT00000024670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPSILALQTPQPRSHPCPAMVNPNVFFNIIIDGKSLGHVSFELFCALSTGEKGFGYKVSC
FHRIILGFMCQGGDFTHHNGTGGKSIYGEKFDDENFILKHMGPGLATANAGPNTNSSQFL
IGTAKPERLDGKHVAFGQVSGSMDIVAATECFGSRMAGPSGKIINADCGQC
Download sequence
Identical sequences G1Q1E0
ENSMLUP00000017523 ENSMLUP00000017523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]