SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018205 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018205
Domain Number 1 Region: 718-773
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000867
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 488-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000119
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 3 Region: 94-144
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000631
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 4 Region: 536-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000326
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 626-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000133
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 780-805
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000028
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number 7 Region: 579-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000003
Family Classic zinc finger, C2H2 0.071
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000018205
Domain Number - Region: 151-183
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00445
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number - Region: 190-288
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.00565
Family Galactoside acetyltransferase-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018205   Gene: ENSMLUG00000004634   Transcript: ENSMLUT00000027013
Sequence length 887
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430322:329144:335324:-1 gene:ENSMLUG00000004634 transcript:ENSMLUT00000027013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVRGPQCPHWPSSTMTDPFCVGGGRRLLGSSKSGPGKDGSQNEVRLPVRHDPKLGLPVAR
GGQTMPSQAPLCFDPGSPASDRTEGKKKGRPKAENQALRDIPLSLMTQWKDEFKVHSRVK
CPSSGCWLEFPSIYGLKYHYQRCQGGAISERLTFPCPFCEAAFTSKTQLEKHRIWNHMDR
PLSAPKPGPVSRPVTISRPVGVSKPIGVSKPVTIGKPVGVSKPIGISKPVTVSRPVPVTK
PVTISRPVPVTKPVTISRPVPVTKPVPVSRPVPVTKPVPVSRPVPVTKPVPVSRPVPVTK
SVTVSSRPMAISRHTPSCKMVLLTKSENKTPRATGRASGKKRAADSRDACPLPPKQARSE
SGECGPPTTGQGSALQPSTDPSSGPLSLGSRPLGGKEVPRATGPVSLPEEGAERMKHRRK
QKTPKKFTGEQPSISGTFGLKGLAKAEDKSRGYRAKKQEGPGPEDVRKKAPAPANTVSKE
APAPVAHSTPGGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGLKKHMEVCQKLQDALKCQ
HCRKQFKSKAGLNYHTMAEHSAKPSDTEASEGSEQEERERLRKVLKQMGRLRCPQEGCGA
AFSSLMGYQYHQQRCGKPPCEVDSPSFPCTHCGKTYRSKAGHDYHMRSEHTAPPPEEPQD
KPPEAEDLLGIERTPSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPETARLN
YTRPGLPTLNPQLLETWKNEVKEKGHVNCPNDCCEAIYSSVSGLKAHLASCSKGDHLVEK
YRCLLCPKEFSSESGVKYHILKAHAENWFRTSADSPPKHRSQGSLVPKKEKSLAGGKKRG
RRPKERLPEEPAPKMAPRQEDWPPGGRDKGAQDSTGRKVGASNSPEK
Download sequence
Identical sequences G1Q3C2
ENSMLUP00000018205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]