SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018580 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018580
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily Ferritin-like 5.41e-33
Family Ferritin 0.00000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018580   Gene: ENSMLUG00000028621   Transcript: ENSMLUT00000028504
Sequence length 149
Comment pep:novel scaffold:Myoluc2.0:GL429858:2560536:2561043:1 gene:ENSMLUG00000028621 transcript:ENSMLUT00000028504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSQIRQNDSTELEAAANLLINLHLRASDIYLSLRFFDHGDVALEGMSRLFQELAEEKCK
TTSPGRAGLQDVQKPSQDKDTLEAARVMEKNLNQTLLGIHTLSSAGTHPHLCDFLENHFL
DEEVKLIKKMGNTAELGEYVFERLALKHN
Download sequence
Identical sequences G1Q4E7
ENSMLUP00000018580 ENSMLUP00000018580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]