SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019466 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019466
Domain Number 1 Region: 288-462
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-56
Family SPRY domain 0.0000495
Further Details:      
 
Domain Number 2 Region: 6-76
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-21
Family RING finger domain, C3HC4 0.0073
Further Details:      
 
Domain Number 3 Region: 93-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000183
Family B-box zinc-binding domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000019466
Domain Number - Region: 135-197
Classification Level Classification E-value
Superfamily t-snare proteins 0.0785
Family t-snare proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019466   Gene: ENSMLUG00000002174   Transcript: ENSMLUT00000002171
Sequence length 468
Comment pep:novel scaffold:Myoluc2.0:GL429768:23303881:23305287:1 gene:ENSMLUG00000002174 transcript:ENSMLUT00000002171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIEAALAVLQTEINCPICLDDLRDPVTIECGHNFCRSCIQQSWADVQDRFPCPVCRHPC
KDRHMRSNTQLGRMVDITKLLQITRGKMKQQEERRFCKKHNKSLTLFCEEDRELLCPLCT
QPPDHQGHQVRPVEEAASHHRQRLSSYIEPLKKQVADIQKLVATQDRKLSELREKVENRR
AKLASEFDNLIQSVEHEQEAVLSRVAAEEKHIQRNLIANKTAFSDHISKLKVQLKEMAEK
SVMSDVKLLMNIKGVFRHCENLEPPGVYCFQFSREEFSLPPQCSALQKIIQRFREEVTLD
PETAHPNLVVSEDKKSVTFVRKKQRVHKNPKGFAVDPVVLGTEGFDCGRHYWEVQVDDKP
EWAVGVCKDTLSKEEKQPLLRQENRCWTIQLKDGDYVAQGPVPVTLVLKEMPRGIGIYLD
YELGQVSFYSLNDMSHIHSFRDTFSEVLKPYFYVGCDPKPLTVFALKD
Download sequence
Identical sequences G1Q6Y3
XP_006082058.1.53796 ENSMLUP00000019466 ENSMLUP00000019466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]